KEGG   Tribolium castaneum (red flour beetle): 659920
Entry
659920            CDS       T01046                                 
Name
(RefSeq) putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    659920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    659920
Enzymes [BR:tca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     659920
Spliceosome [BR:tca03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    659920
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    659920
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_30 Flavi_DEAD DUF2075 AAA_22 AAA_19 T2SSE SRP54 TsaE
Other DBs
NCBI-GeneID: 659920
NCBI-ProteinID: XP_971279
UniProt: D6WL19
Position
LG5:complement(8402823..8408396)
AA seq 892 aa
MGKKDKKGRKRYESSSDSESVDSEEEARRKDLKERDEFASRLKKRDEAKVRNIVQASDRR
AYEEAAKRLKLETEDREKMIPALRVQSRRKYLEKRKDDKIAELEEDIADDEYLFEEEILT
EREKKERDRKRELLRLAQEHEKARELERVQRYHMPRDLGKGSTADYVEVDELEKVPQSEQ
KKWEKDQMASAVFKFGAKDSAKKDEYDLLLEDQIDFIQVLQMPGTREKKEPELTEKEKKK
LDIQETKKNLPVYPFRDDLIQAVREHQVLIIEGETGSGKTTQIPQYLHEAGFTNDNKKIG
CTQPRRVAAMSVAARVAQEMEVKLGNEVGYAIRFEDCTSERTIIKYMTDGTLHREFLSEP
DLQSYSVMIIDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATLDAQKFSEFFDDAPI
FRIPGRRFPVDIYYTKAPEADYVDACVVSVLQIHATQPLGDILVFLTGQDEIETCQELLQ
DRVRRLGSKVKELIILPVYANLPSDMQAKIFEPTPPGARKVVLATNIAETSLTIDNIIYV
IDPGFAKQNHFNSRTGMESLIVVPISKASANQRAGRAGRVAAGKCFRLYTAWSYKHELED
NTVPEIQRINLGNAVLMLKALGINDLVHFDFLDPPPHETLVLALEQLYALGALNHHGELT
KLGRRMAEFPVDPMMAKMLLASEKYKCSEEIVTIAAMLSVNGAIFYRPKDKIIHADTARK
NFNHIGGDHLSLLNVYNQWRDSDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDM
VSNITEAADIKKAITAGYFYHIARLSKGGTYKTVKHNQSVTIHPNSALFEDLPRWVLYHE
LVFTTKEFMRQVIEIESKWLLEVAPHYYKQKELEDSTNKKMPKTVGRSTRTE
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgggcaaaaaagacaagaaggggcgtaagcgctacgaatcgagctcggactccgagtcc
gtggacagtgaggaagaagctcgtcgtaaagacctgaaagaacgtgacgagttcgctagt
agactcaaaaaacgcgatgaagccaaagtccgcaacattgtccaggcctcagaccggcgc
gcttacgaggaagccgccaagagactcaaactggaaactgaagaccgcgaaaaaatgatc
cccgccttgagggtgcagtcaagacgtaaatatttagagaaacgtaaagatgataaaatc
gcggaattggaggaggatatcgctgacgatgagtatttgttcgaggaggagatattaaca
gaacgtgagaaaaaggagcgcgaccgtaagcgggaattgctgcggttggcacaggaacat
gaaaaagcgcgtgaattggaaagggtgcagcggtaccacatgcccagggatttgggcaag
gggtcaacagcggactatgtggaagttgatgagctggaaaaggtgccccagtcggagcag
aagaaatgggagaaggaccaaatggcgtcggcggtcttcaagttcggggccaaggattca
gccaagaaggacgagtacgatttgttgctggaggaccagattgacttcatccaagtcttg
caaatgccaggcacacgagagaagaaagagcccgaactaaccgaaaaggaaaaaaagaag
ctcgacatccaagaaacgaagaaaaacctcccagtctacccgtttcgcgacgacttgatc
caggccgtccgcgagcaccaggtcctaataatcgagggtgaaaccggctctggaaaaaca
acccaaatcccgcagtacttgcacgaagccggcttcaccaacgacaataaaaaaatcggc
tgtacgcagccacgccgtgtcgccgccatgtcggtagcggcccgcgtagcccaagaaatg
gaagtcaaactcggcaacgaagtcggttatgcgatcagattcgaagattgcacatccgaa
cgtacaatcatcaaatacatgaccgacggcacgctccaccgcgaatttttatccgagccc
gacctgcagtcctacagcgtcatgatcatcgacgaggcccacgagcggacgctacacacg
gacattttgttcggtctggtcaaagacatcgcccggtttcgccccgacttgaaactgctg
atttcgagcgcaacgctcgacgcgcaaaaattctccgagtttttcgacgatgcgcccatt
ttccgcattccaggccggaggtttccggtggatatttactacactaaggcgccagaggcc
gattatgtggacgcgtgcgttgtttccgttctacaaattcacgcgactcaaccgttaggg
gatattcttgtttttttgaccggtcaggatgagattgagacgtgtcaggagttgttgcag
gatcgggttcgccggttgggctccaaagtcaaggaactgattattctgcccgtttatgcg
aacctgccaagcgacatgcaagcgaaaatttttgaaccgacgcctccaggggcccggaaa
gttgtgcttgcgacaaatatagcggagacttctttaacgatagacaatataatctatgtt
attgatcccggttttgccaaacaaaaccacttcaattcgcggactgggatggagagcctg
attgtggtgccaatttcgaaagcctcggctaatcagagggctgggagggctggcagagtg
gcggccgggaagtgttttcgtttgtacaccgcctggtcctacaagcatgaactggaggac
aataccgtgccggaaatacaaaggattaatttaggcaacgctgtactgatgctgaaagcg
ttggggattaacgatttggtgcatttcgattttcttgatccgccaccacatgagacactt
gttctggcactggaacagttgtatgctttaggggcgttgaaccatcacggggagttgacg
aagttggggcgcaggatggcggagtttccggttgatccgatgatggccaaaatgttgtta
gcttcggaaaaatacaaatgttcagaggagattgtgactattgcggccatgctttcggtc
aatggggcgattttttacaggcccaaggataaaattattcatgctgacacggcacgcaaa
aattttaatcacatagggggtgaccatctgagcttgttaaatgtgtacaaccagtggagg
gattccgattattccacccaatggtgctacgagaattttatacaatacagatctatgaaa
agggctcgcgatgtgagggaacagttggtcggtttaatgcaaagggttgaaatcgacatg
gtgtcaaatataaccgaggctgcagacattaaaaaggctataaccgccggttatttctac
cacattgctcggttatccaaaggagggacttacaaaaccgttaaacataatcagagtgtc
acaatacatcccaatagtgccctttttgaggacttgccaagatgggttctttatcacgag
ctggtttttaccaccaaagagtttatgagacaagttatagaaatcgagagtaagtggctt
ttggaggttgcacctcattattacaagcagaaggaactggaggattctaccaacaaaaaa
atgccaaagactgtcgggcgtagcaccagaactgaataa

DBGET integrated database retrieval system