KEGG   Tribolium castaneum (red flour beetle): 660041
Entry
660041            CDS       T01046                                 

Name
(RefSeq) Krueppel-like factor 11
  KO
K13943  cabut
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tca03000]
    660041
Transcription factors [BR:tca03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    660041
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 zf-C2H2_8 DUF6063 zf-C2H2_6
Other DBs
NCBI-GeneID: 660041
NCBI-ProteinID: XP_971397
Position
LG5
AA seq 309 aa
MESNMINEEVTHLLSPPSTPPMKNVSDEESTLQSLRTLLERKRASPILLTPQPSDSEPEE
LDYPPKKRFCKNETELARHLLSHTPPPEPPRTFSVIMHANKDGSCTRAPIPLEPQMNILR
SLKFKMGTRKEKVYVNSKDTGKEPPKQTSKIILPAIAPKFNQPQAVFLAADGTTTFIPGA
QLVLLTPTPPQPPPPARRRVYECTFKGCNKNYFKSSHLKAHNRKHTGEKPYKCEWEDCGR
RFSRSDELSRHKRTHTGEKKYKCSFCDRGFMRSDHLTKHVKRHTKDRAGLQPQKMFVPGL
LRPLQPAPA
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagtcaaacatgatcaacgaagaggtcacacacttgctgtcacctcccagcacaccc
cccatgaaaaacgtgtccgatgaagagtccactcttcagtccttgcggactctcttggag
aggaaacgcgcctccccaatcctcctcaccccccaaccctcggactcagagcccgaggag
ttggactaccctcccaaaaaacgtttttgtaaaaacgaaaccgagttggcccgccacctc
ctcagccacactccaccccctgaaccccctcgcaccttctccgtaataatgcacgccaac
aaagacggctcctgcacccgcgcccccatccccctggaaccccaaatgaacatcctccgc
agcctcaagttcaaaatggggacgcgcaaggagaaggtctacgtcaacagcaaagacacg
ggcaaagaaccccccaaacagacgtcgaagatcatcctccctgccatcgcccccaagttc
aaccagccccaggctgtcttcctggcggctgacgggacgaccacgttcatcccgggggcg
cagttggtgttgctgacgccgacgcccccgcagccgcccccgccagcccggcgcagggtg
tacgagtgcacgttcaagggatgcaataagaattatttcaagtcgtcgcatctcaaggcg
cacaataggaagcacacgggggagaagccctataagtgcgagtgggaggactgtgggagg
aggttctcgcggtcggatgagttgtcgaggcataagaggactcatacgggcgaaaagaag
tacaagtgtagtttttgcgatagggggttcatgcggtcggatcatttgaccaaacatgtg
aaaaggcatacgaaagacagggcggggttgcagccccagaaaatgttcgtgccggggctg
ctgaggccgctgcagccagcgccagcctaa

DBGET integrated database retrieval system