KEGG   Tribolium castaneum (red flour beetle): 660093
Entry
660093            CDS       T01046                                 

Definition
(RefSeq) dnaJ homolog subfamily A member 1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    660093
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tca03110]
    660093
   04131 Membrane trafficking [BR:tca04131]
    660093
Chaperones and folding catalysts [BR:tca03110]
 Heat shock proteins
  HSP40 / DNAJ
   660093
Membrane trafficking [BR:tca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    660093
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG HypA Anti-TRAP DUF5351
Other DBs
NCBI-GeneID: 660093
NCBI-ProteinID: XP_971446
UniProt: D6W9F5
Position
LG2
AA seq 403 aa
MVKETKFYDILGVKPGCTQDDLKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDPEK
KRIYDQGGEQALKEGGVSGGFSSPMDLFDMFFGGGGFGGGRGRRRERKGKDVIHQLNVSL
EELYKGTVRKLALQKNVICDKCEGRGGKKGAVETCPTCRGSGMQVQIQQLGPGMIQQIQS
MCSDCRGQGQRINPKDRCKQCQGKKVTRERKILEVHVDKGMVDGQKIVFNGEGDQEPELE
PGDIIIVLEEKEHPVFRRSGLDLIIRLELQLVESLCGFQKVIRTLDDRDLVITSLPGEVT
KHGDVKCIMNEGMPQYKNPFEKGRLIVQFLVQFPDKLPPEVIPALENALPPRPEIMIPDQ
AEECILLPFDVDKQDSRRRQNRNVYDEDDEMHGPGQRVQCAAN
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggtaaaagagacgaaattctacgacatcctgggcgttaagcccggctgcacccaggac
gacctgaagaaagcctaccgaaaactcgcccttaaataccaccccgacaagaaccccaat
gaaggggagaagttcaagcaaatctcgcaagcgtacgaggtgctgtccgacccggaaaag
aagcgcatttacgaccaaggcggcgaacaggccctcaaagagggcggcgtctcgggcggc
ttctccagccctatggacttgttcgatatgttcttcggcggaggcggctttggtggcggc
agaggccgacgtcgcgaacgtaaaggcaaagatgtcattcatcaacttaatgtttctctg
gaagagttgtacaaaggaaccgtccggaaattggctctacagaaaaacgtcatctgtgat
aagtgcgaaggcaggggtgggaagaagggggctgtggagacgtgtcccacgtgtcggggc
tccggcatgcaggtgcaaatccagcagttggggccaggcatgatccaacaaatccagagc
atgtgttcggattgccgaggccaaggtcaacgcatcaatcccaaagaccgttgcaagcaa
tgccaaggcaagaaagtgactcgcgaacgcaaaattctcgaagtccacgtggacaagggc
atggttgacggtcaaaaaatcgtttttaacggagaaggggaccaagaaccagaactggaa
cctggcgatattataattgtgcttgaggagaaagaacatcccgtttttcgaagatccggc
ttggatctcataatccgccttgagttgcagttagtagagtcgctttgcggattccagaaa
gtaatcaggactttggacgaccgcgatttggttatcacgtcgcttccgggcgaggtcacg
aaacacggggatgttaagtgtattatgaacgagggaatgccgcagtataagaatccgttc
gagaaaggacggcttatcgtacaatttttggtacagtttccggataagttgccacctgag
gtgattccggcgctggagaatgcgctaccgcctcggcctgaaattatgatcccggatcag
gcggaagaatgcattttgttgccgtttgatgtggataagcaggactcgaggaggaggcag
aataggaatgtttatgacgaagatgatgagatgcatggtccgggacagcgggtccaatgt
gcggctaactaa

DBGET integrated database retrieval system