KEGG   Tribolium castaneum (red flour beetle): 660338
Entry
660338            CDS       T01046                                 
Name
(RefSeq) thioredoxin domain-containing protein 5
  KO
K13984  thioredoxin domain-containing protein 5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    660338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tca03110]
    660338
   04131 Membrane trafficking [BR:tca04131]
    660338
Chaperones and folding catalysts [BR:tca03110]
 Protein folding catalysts
  Protein disulfide isomerase
   660338
Membrane trafficking [BR:tca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    660338
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 OST3_OST6 Thioredoxin_8 Thioredoxin_7 Thioredoxin_9 Thioredoxin_6 TraF Redoxin Thioredoxin_5 AAA_33
Other DBs
NCBI-GeneID: 660338
NCBI-ProteinID: XP_008200981
UniProt: D6WD23
Position
LG2:5472989..5475010
AA seq 382 aa
MSSKLSVLVLFAVFVNVFSHDDDVHTVKYTTENFAQELPKKNHFVMFYAPWCGHCQRLGP
TWEQLAEMLNEDDSNIRIAKVDCTTDSSLCSEHDVTGYPTLKFFKVGASEGIKFRGTRDL
PTLTTFINEQLREGDEEDAEKKPPQPVSGLVELTEDTFEKFVATGKHFIKFYAPWCGHCQ
KLAPVWEQLAKSLEFDSSISIAKVDCTQWRLVCNQFEVKGYPTLLWIEDGKKVDKYQGDR
THEDLKNYVSKMMGSSEIPTETEKPQSEEGAVGILTGDTFKHGIETGITFVKFFAPWCGH
CKRLAPTWDELGKKFVADSNVNIAKVDCTLDLNKDLCNEQEVEGFPTIFLYKNGDKISEY
SGSRTLEDLYEFVKQHVGHDEL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgtcttcaaaactatcagtgttagtgttatttgcggtcttcgtaaatgtattcagtcac
gatgatgatgtgcacactgtcaaatacaccacagagaattttgcccaagaattaccaaag
aaaaaccattttgtcatgttctacgccccttggtgtgggcattgccaaagacttggcccc
acttgggaacaacttgccgaaatgctcaatgaagacgatagtaacataagaatcgctaaa
gtggactgcacaacggatagctccttgtgttcggagcatgacgtaacgggctaccctacc
ctcaagttcttcaaagttggggcttctgaaggtatcaagtttaggggtacgagggattta
cccacgcttactacgttcataaatgagcagttgagagagggggatgaggaagacgctgaa
aagaagcccccacagcctgtgagtggactcgttgaattgactgaagacacttttgaaaaa
tttgtggccactgggaagcattttattaagttttatgcgccgtggtgtggccattgtcag
aaactggctccagtgtgggaacagttggccaaatctttagaattcgattcaagtatttct
atcgcgaaagttgattgcacccaatggaggctagtttgtaaccagtttgaagtcaagggt
tacccaactcttttatggatcgaagatggtaaaaaagttgacaaataccaaggcgacaga
acgcacgaagatttgaaaaactatgttagcaaaatgatgggttcttctgaaataccaact
gagacggaaaaaccgcagtctgaggaaggtgctgtcggaatcctcactggtgatacgttc
aagcatggcatagagacaggtatcacttttgttaaattttttgcgccatggtgtggtcat
tgtaagcgtttggcgcccacttgggacgagttaggcaaaaaatttgtagcagactcgaac
gtaaatattgccaaagttgattgtactcttgatctaaataaagatttgtgcaatgagcag
gaggttgaagggtttccaacaatctttctctataaaaatggcgataaaatatcggaatat
agtggaagtcggactttggaagatttgtacgaatttgttaaacaacatgtggggcatgat
gagctttaa

DBGET integrated database retrieval system