KEGG   Tribolium castaneum (red flour beetle): 660987
Entry
660987            CDS       T01046                                 
Name
(RefSeq) SLIT-ROBO Rho GTPase-activating protein 1
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    660987
Membrane trafficking [BR:tca04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    660987
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    660987
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_9 SH3_2 SKA2 FlaC_arch
Other DBs
NCBI-GeneID: 660987
NCBI-ProteinID: XP_008193451
UniProt: D6W740
Position
LGX:complement(3360974..3387637)
AA seq 1115 aa
MDENEQELKSPIKRLGSTRKLLVFNNIRLQLNEQLRCLDMRMEAQVALVTELQDFFRRRG
ELELDYSKNLDKLAKSLQLRHKEQKQKREQWPLFSSYTCWQQLVTQTKNLSRDHVALSEV
YSTHLVSRLSQVMEDVQRIYKRCREIGYETHEEILRVLHELHTTMKTYHSYQAELRQAEA
KLKSAETQRAKLEQSLSQDKLDRSKKYKLMEKEVMKRKNKYTDAKLKALKARNEYILCLE
ASNTTIHKYFVDDLSDLIDCMDFGFHNCISRALLMHVTAEEGRQRSVQNGLDTLSACINS
LDSRLDKQRFLEYNHTAFMIPKKLEFQGQKQEEPAEPEIQKVLHQEMESRLRQLQQRVTS
LRTESEEVWKTLETAESTLLEMLNAKDYDCSAYFGENAVPASKPPETVSIKLRADRQETE
EFYLTKFREYLLGSTKIARLDAKQEYIRQSLLSEAPDYCSTLKPVVKTPRRKRIGRLQMS
GQPKLFGGSLEEYLEATNQDIPLIMKSCIRVINLYGLHHQGIFRVSGSQVEINNFREWFE
RGEDPLADMTDASDINSVAGVLKLYLRELREPLFPIIYFEQFMELAQLESKREFIVRMKE
LINSLPRTVIVVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPDDKDQVQYQNQ
VNELIKNIIMFNEEIFPNDGGTVYEKYISPEPDDHDVGDLPSDQVPEDLDSEVYPSEDDS
ENMEATAQFDFIARSDRELSLKKGDTVTLYSQVSNDWWKGSVKGQEGLIPDKYISLKMKD
DDREKLENLKSSSSEESMRRRVSSSNDSMLSESSVSASNSPLVQCAPVTWTNVSDMNESI
SSENNSVILNQTRENGHNRLKSLDISLESHLLNRMRDPVVTINVNQTPQNITINGSPVMQ
SRKLEKSETVPEIGKSETDIELRHKSEIDESNLNFSQNREQWQRRAVSQSHIPLSQPQTL
KANRNSESYLQRQNHTPDLVMDLPLVGNSSPKETTKKSMSVSGNLTSEGPLGDESHKSPE
SPDMQTAAERFAKQNQCTLKKNTKVHVDSSDSAETNLITITSPMPERKYATIGSATTTFK
PQLKAKPPVLKKPAFSVPMAAVSSEVRKDQPDLPT
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggatgaaaatgagcaagaattgaaatcaccaatcaaacggctgggatccacgagaaaa
cttttggtttttaacaatatccgtttgcaactcaacgagcagttgcgatgtctagatatg
cgaatggaggcccaggtcgctctagtaacggagttgcaagactttttccggcgcagaggt
gaactagaactcgactattcgaaaaatttagataaactagcgaaaagcttgcagcttcgg
cacaaggaacaaaaacaaaaacgagaacaatggcctttattttcgagttatacgtgttgg
caacaattagtaacgcagactaaaaatctaagcagggatcatgtagctttatccgaagtt
tactccacgcatttggtctccaggctgtcgcaggtcatggaggacgtccagaggatctac
aagaggtgccgggaaatcggatacgagactcacgaggagatactacgtgtcttgcacgag
cttcacacaacaatgaaaacatatcacagttatcaggcggaactgcgccaagcggaggcc
aagctaaaatcagccgaaacccaaagagcgaaattagagcagtccctgtcccaggacaag
ttagataggtcgaaaaagtacaagctgatggagaaggaagtgatgaagcgcaaaaacaaa
tacacggatgcgaaattgaaagctctcaaagcccggaacgagtatattttatgtttagag
gcttccaacaccacaatccacaaatacttcgtcgacgatttatccgatctcattgattgc
atggatttcggtttccacaactgcatatcccgggcgcttctgatgcacgtaacggcggag
gagggccgccagaggtcggtccagaacggcttagacaccctatcagcgtgcattaattcc
ctagactcgagattagacaaacagcggttccttgagtacaaccacacggcgttcatgatt
ccgaaaaaactcgaattccaaggacagaagcaggaagagcccgctgaaccagaaatccaa
aaagtcctgcaccaggagatggagagccgattacgccagctgcagcaaagggtgacctcg
ctcaggaccgagtcggaggaggtctggaagacgctggaaaccgccgaatccaccctgctg
gagatgctcaacgcgaaagactacgactgtagcgcctattttggcgaaaacgcggtgcca
gccagcaaaccgcccgaaaccgtctccatcaagctacgggcggaccggcaggagaccgaa
gagttctatctaacgaaattccgagagtatttattgggatcaacaaaaatcgctcgccta
gacgctaagcaagagtacataagacaatcgctgctgtccgaagcgcccgactattgtagc
acccttaaaccagtcgtcaagactccccgccggaaacgaatcggtcggctgcaaatgagt
ggccagccgaagttgtttggcgggtccttagaggagtatttggaggccacgaatcaagac
attcctctcattatgaagtcttgcattagggttattaatttatacggtctacaccaccag
ggtattttccgggtgtcggggtcccaagtcgagataaataacttcagggagtggttcgaa
cggggcgaagatccgctcgctgatatgacggacgcgtctgatatcaacagcgtggcgggg
gttttgaaactgtatctgcgggaactgcgcgagccgctcttcccgatcatttatttcgaa
caattcatggagcttgcacaattagagtctaagcgggaattcattgttaggatgaaggag
cttatcaatagtttaccaagaactgtgatagttgtgatgcggtacctcttcgccttcctt
aaccacttgtcggagttttccgacgagaacatgatggatccttacaacctagccatttgt
tttgggccgacgctagtgccggttcccgacgacaaggaccaagttcagtaccagaaccaa
gttaacgaactcattaagaatattattatgtttaacgaggaaattttccccaacgacggt
ggcacggtctatgagaagtatatatccccggaaccggatgaccacgacgttggggatctg
ccatctgaccaggtgccagaagacctggactccgaagtatacccatctgaagatgattct
gaaaacatggaagcgacggcgcagttcgacttcatcgcaaggtctgaccgagaactgtcg
ctgaagaaaggcgacaccgtgacgttgtattcccaagtgtcgaacgactggtggaagggg
tcggttaaggggcaggaagggttgattccagacaaatatatatctctaaaaatgaaagat
gatgatcgagagaagctggaaaacctgaaatcgagctcgtctgaggagtcgatgcggcgg
agagtctccagttcgaacgactcgatgttgtccgagagctccgtctctgcgagcaattcg
cccctagtgcagtgcgccccagtgacatggactaacgtgtcagacatgaacgaatcaatc
tcatccgaaaacaactcagtaattttaaaccagacgagagagaacggacacaaccgcctt
aaatccctggacatatctctagaatcccacttattgaatcgtatgcgcgatcccgtcgtc
accataaacgtgaaccaaaccccgcaaaatatcacaataaacggttcccctgtcatgcaa
tcccgcaaattagagaagagcgaaacggttcccgaaatcggaaaatcggagaccgacatc
gaactgcgccacaagtcggaaatcgacgaatcgaacctaaatttcagccaaaaccgcgag
cagtggcagcgccgggcggtctcccagtcgcacatccccctgtcccagccccagaccctg
aaggcgaaccggaactccgagtcctacctgcagcggcagaaccacactccggacctggtc
atggacctccccctggtcggcaactcgagtccgaaggaaaccacgaagaagtccatgtcc
gtgtcgggtaacttgacctctgaggggccgctgggcgacgagagccacaagtcgcccgag
agccccgacatgcagacggcggccgaacggttcgccaagcagaaccaatgcacgctcaag
aagaacaccaaagttcacgttgacagcagcgacagtgctgagacgaatctgatcacgatc
actagtcccatgcccgagcgcaagtatgcgacgatcgggagcgcgaccacgacgttcaag
ccccagctcaaagcgaaacctccagtgctcaagaaacccgcgttttcggtgcccatggcg
gcagtctcaagcgaagtacgaaaagaccaaccggatcttcccacgtaa

DBGET integrated database retrieval system