KEGG   Tribolium castaneum (red flour beetle): 661138
Entry
661138            CDS       T01046                                 
Name
(RefSeq) eye-specific diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00561  Glycerolipid metabolism
tca00564  Glycerophospholipid metabolism
tca01100  Metabolic pathways
tca04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    661138
   00564 Glycerophospholipid metabolism
    661138
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    661138
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     661138
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_5 Ank_3 Ank Ank_4 PSD4
Other DBs
NCBI-GeneID: 661138
NCBI-ProteinID: XP_015840616
Position
LG2:5736891..5828309
AA seq 1242 aa
MQRLRTTFKRSRTPTGAEMKTQSSLEVPKQVRSASFDEIQLEAKRLQSGGQSTDPSALLR
VPQFPGQRSRSVDSGGSEESGNFLEVPARRFQRRRSSSSKSPVCVHCVCLEEYAKLHPAE
EQPPEPPDELPLPTSSISDSSSECEEEVLPECSITVTLSPILPPPPIQSPPPLPASPVIE
FFPTEDVQTPTTPTRRKSIHRQEAFFAEPTGTSLENMSDGPSELYSEGTSEGALSEGDAV
NATIPGLVVRDIYLQVPDLKRDRAASVDSCFSKVSQGKTEELQHSGVSLEVPVGPNVALR
SRSVDIVLPTDEHARYKALAMAAAPGTSSSYYKGKVVGDVGERVLRSTPDWGETAINGDH
LWVPTSVSGDFCYIGDMDCTKHGARMKCSACNVVAHQNCIGILMDKMRFTCKPTFRDVGV
RQYREQTSIHHHWVHRRSEKGKCRQCGKSFQSKLSFSSKEIVAISCSWCKAAYHNKDTCF
NMQRIGEECNLGVHRSIVVPPSWIVKLPRKGSFKSSLRKSPKKRASSKRKTKEKDKEHRT
FAIKPIPTTNVTPVIVFINPKSGGNQGSKLLQKFQWLLNPRQVFDLTQGGPKMGLELFKK
VPNLRVLACGGDGTVGWVLSVIDQIGISPAPAVGVLPLGTGNDLARALGWGGGYTDEPIS
KILSNISASETVLLDRWSLEVEKNPNAEANEGGKDNLPLNVVNNYYSLGVDAHIALEFHE
AREAHPEKFNSRLRNKMFYGQMGGKDLLKRKWKGLADFVTLECDGKDLTPKLKELKVHAI
VFLNIPSYGGGTRPWNRSMGTCEPSTDDGLIEVVGLTTYQLPLLQAGGHGTCITQCRSAK
IVTSKTIPMQVDGEACKLNPSIINLSLLNKAPMLAKRKCGKPNVPQTALDNLKICVHRIS
MADYEQHHYDKDLLAQAAISVGTIEVNPIWDLEQVRALINKFIEDCKDQQKIHPEWCFLD
SCTAERFFRIDKAQENLHYVLDIAVDNLYILECGGGTVPQTPEDETATPSPSSINQTSYI
IPEMRVSDEGSLDSPSDQPPMSPKILQSPEEFPSETIAEENRNGDKQLARISPDASVKIR
SITERLFGLSQESYSVYRDLPQKPNEALLKAAKVGDLKTVKELHSQGYSLLTKDPAGQTM
LHYASRYGHKDIVKYLLQHAPPSILNIKDVNLGQTALHKAAAYKWRSICCMLVAGGAALD
ITDRRGLTPRLLALQSDDHDLAAYLESQEHFQLVSSSLGTVV
NT seq 3729 nt   +upstreamnt  +downstreamnt
atgcagcggctcaggaccacgtttaaacggtcccgaactccgactggtgccgaaatgaag
actcaaagcagtctggaggtgcccaagcaggtgcgctctgcctctttcgacgagattcag
ttggaggcgaagcgactgcaatcggggggtcagtcgaccgacccttcggcgcttctcaga
gtgccccagttccccggacagcgttcgaggagtgtcgattcgggaggtagcgaagaatcc
ggcaatttcctcgaagtaccggcgcgacgatttcaacggcgccgctcctcaagcagcaaa
agtccggtctgtgtgcactgcgtttgcttggaggagtacgccaaactacatccggcggaa
gaacagccgccggaaccgccggacgagttgccgctacccacttccagcatcagcgactcc
tccagcgaatgcgaagaagaagtcctcccagaatgctccatcacagtcactctctccccc
atactacctccccctcccatccaatccccaccaccgcttcctgcatcccctgtcatcgaa
tttttcccaactgaagatgtccaaacaccgaccacgccaacaaggcggaaatcaattcac
cgtcaagaagcttttttcgccgaaccaactggaacctctttggagaatatgtcagatggt
ccgtctgaactgtactcagaggggacatcggaaggagcactgtctgaaggggacgctgtt
aacgccaccataccgggcttggtagtccgagatatttacttgcaagtccctgacttgaaa
cgcgacagagctgcgtctgttgattcgtgtttttcgaaagtctcgcaaggaaaaaccgag
gagttacaacattccggggttagtttggaggtgccagtggggccaaatgtggctttacgg
tcacggtctgtggatatcgtattgccaacagatgaacatgccaggtacaaggccttggct
atggccgcagcgcctggcacttcttcgtcttattacaaggggaaagttgtcggcgatgtt
ggagaaagggtcctccggagtactccggactggggcgaaactgcaatcaacggtgatcat
ttatgggttcccacatcggtctcgggtgacttttgctacatcggagatatggactgcacg
aaacacggtgcccggatgaagtgttccgcttgtaatgtggtcgcgcaccagaattgcatc
gggatcttgatggataagatgcgatttacatgcaagcctacgttccgtgatgtgggagtt
agacagtacagagaacagacctccatccatcaccattgggtccaccgacggtcagagaag
ggtaaatgtcgacaatgcggcaagtcattccagtccaagttatcgtttagttcgaaagaa
atagtcgcaattagttgttcgtggtgcaaggctgcttatcacaataaggacacctgcttt
aatatgcaacgaataggcgaggagtgcaatttaggtgttcatcgcagcattgtggttcct
ccttcgtggatcgtgaaactgcctcgcaaaggaagtttcaagtcaagtctgagaaaatct
ccgaagaaacgggcttccagcaagcgaaaaaccaaggaaaaggataaagagcacagaacg
ttcgccatcaagccgatccccacaaccaacgtaacgcccgtcatagtgttcatcaaccct
aagtccgggggtaaccaaggatcaaagttgctccagaaattccagtggttgttgaatccg
cgacaggtgtttgacttgacacagggcggtcccaagatgggtctcgaactgttcaagaaa
gtacctaatctacgtgttcttgcctgcggcggagatggaaccgttggttgggttttaagt
gttatcgaccaaatcgggatctctcctgctccagcggtcggcgttcttcctctaggaaca
ggaaatgatctggcaagggcgctcggatggggtgggggttatacggatgaaccaatatcg
aaaatcctgtccaatattagcgctagcgagactgtgttattagataggtggtctttagag
gttgagaagaacccgaacgctgaggctaacgaaggcggcaaggataatttgcctctcaac
gttgtaaataattattattcattaggtgtcgatgctcatattgccttagaattccacgaa
gctcgagaagctcatcccgaaaaattcaattctagattaaggaacaaaatgttttatggc
cagatgggcggcaaagacttgctcaagcgaaagtggaagggtttagctgatttcgtcacg
ttagaatgcgacggcaaagacctaacacccaaactgaaagagcttaaagtacacgcgatt
gtcttcttaaacattccaagttatggtgggggaacaaggccctggaaccgatccatgggc
acgtgtgagccaagcactgacgacggtttgattgaagtcgtcggtttgacaacatatcag
cttcctttgctacaagctggaggccacggtacttgcattacgcaatgtaggtcggcaaaa
atcgtaacatccaaaacaatacccatgcaagtggatggggaagcttgcaaattaaaccct
tcgatcataaatctttcactgttaaataaagctccaatgctggcaaagcggaagtgtggc
aaacccaacgtaccgcaaactgctctcgacaatctgaaaatttgtgttcatagaattagc
atggctgactatgaacagcaccactatgacaaggatctattagctcaagcggcaataagc
gttggtacaatcgaagttaacccaatctgggatttggaacaagtgagagcgttaattaac
aaatttatagaagactgcaaagaccagcaaaaaatccaccccgagtggtgttttttagac
tcatgtacagctgaacggttcttccgcatcgacaaggcccaagaaaaccttcattacgtg
ctggatatcgcggtcgataacttatacattttggaatgcggaggtggaactgttcctcaa
actcccgaagacgaaacagccacaccgtctcccagttctattaatcaaacatcgtacatt
attccagaaatgcgcgttagtgatgaaggcagcctggattcgccgagcgatcaaccaccg
atgagtccaaaaatcctgcaatctccggaagaatttcccagcgagacaattgcggaagag
aaccgcaacggcgacaagcaattagcgcgcatttcccccgacgctagcgtgaaaataaga
agcatcactgagagactgtttggtttatctcaagaatcttacagtgtctatagggacttg
ccacaaaagccgaacgaagctctcttaaaagccgccaaagtgggggacttgaaaacagtc
aaggaattacacagtcagggctactctctacttaccaaagacccagccggccaaacaatg
ttgcattacgcctcacggtatggccacaaagatattgttaaatacttactccagcacgcc
ccaccttcaattctgaatatcaaagacgtgaacttaggacaaacggcgcttcataaagca
gcagcgtacaagtggcgcagtatttgttgtatgttagtcgccggaggcgcagctttggat
attacagatcgtcgaggtttaactccgagattattagcgttacaatccgacgatcacgat
ttggctgcatacctcgaaagtcaggaacactttcagttggtgtcctccagtttagggact
gttgtatga

DBGET integrated database retrieval system