KEGG   Tribolium castaneum (red flour beetle): 664089
Entry
664089            CDS       T01046                                 
Name
(RefSeq) arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    664089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    664089
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    664089
Membrane trafficking [BR:tca04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    664089
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    664089
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   664089
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_2 Ank_4 Ank_5 BAR Ank Ank_3 OmpH FlgN
Other DBs
NCBI-GeneID: 664089
NCBI-ProteinID: XP_008198327
UniProt: D6X007
Position
LG9:14243009..14247796
AA seq 794 aa
MVGKIDPEECLRDSPKFRSLLEEEEASVDQLEQKLEKILKVCGTMVDSGKTYVAQQSLFA
NSLWELSAHFREDSAVLASLNKLIQSLQEMNKFHTILLDQASRTILKNLTSFIKNDIKTV
RDYKQHFEKISSEFDNVLVRNSQTPRSKQQEVEEMQNVLLAVRSCFGHQALDYVNSISLL
QTKKRHEILSTLLSYMHACTAYYHQGSDLCADLEPFFKELADEIADMREETTTVEKELEN
RHASVNNIEIITPKIGKNLPRMEGYLFKRTSNAFKTWNRRWFYLYDNKLVYRKRSGEEAE
TVMEDDLRLCTVKPVLDGERRFCFEVLSPSKSHMLQADSKEMYEAWIAALQKGIGAAFQR
IHSIECSNNASGQSNHSNDEQSGHSVANYNNNKIKKIRMWEQLLKIPGNNYCCDCGSANP
HWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDDWEPEIIKVMVELGNTIVNQIYEAQ
VPDDFVRATPDCPGTIRESWIKAKYVDKKFVKNLPHFDSQQRTSRASLMEIRKWSVRKIR
RRPRSCDNAKRRAKTQFKSQEDVSRDRISETSESSEAETGNRGVLLFGDLDKQPLDGTID
LSSDQESTAGEGEDTVEEEDIDKLHPNLLLYKAAVAHNLPVMCEALALGADKQWINLEDR
GRSPIHQAILSGSVMPCAYLILNGAKINAQDQNGKTPLHLATQEGHTAQVCLLLKHRADQ
HLEDDEGKVPLQMAEQKEHADIVTLLRLGRLNDEMKESENGLTGDSMFNDVVRDFSQLAC
SHPERLQRQKIDNK
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggtgggtaaaatcgacccggaagagtgcctgcgtgattcccccaagttcaggagtctt
ctggaggaggaggaggccagtgttgatcagctggaacagaagctggagaagatcctgaaa
gtatgtgggacgatggtcgattcgggcaaaacatatgtggcccaacaaagtttgtttgcg
aacagtttgtgggagttgagcgcgcattttcgtgaggattccgctgttctggcctcgctt
aataagttgattcagagcttgcaagaaatgaacaagttccatactatccttctggaccaa
gcctcaagaaccatacttaagaatctcacgtcgtttatcaaaaatgacataaaaaccgtt
cgcgattataagcaacactttgagaaaatctcttccgaatttgacaacgttttagtgcgc
aattcgcaaactcccagaagcaaacagcaggaagttgaggaaatgcagaatgttttattg
gcggtacggtcctgtttcgggcaccaggccctcgattacgtcaacagtattagtttgctt
cagacgaaaaaacggcacgagattttgagcacgttgttatcatatatgcacgcctgtacg
gcttattaccaccaaggttccgatctgtgtgccgacttggagccgtttttcaaagaattg
gccgatgagatcgccgatatgcgcgaggaaaccacaaccgttgaaaaagaattagagaac
agacacgcttctgttaataatattgaaataattacaccgaaaatcgggaaaaatttgcct
aggatggaaggttatttgtttaaaaggacctcgaatgctttcaagacttggaaccggcgt
tggttttacctctatgacaataaattagtttataggaaacgatctggtgaagaggctgag
actgtgatggaggacgatttgcgtctttgtaccgttaaaccggtcctagatggggagagg
cggttttgttttgaggttttgtcaccgtctaagagtcatatgctccaagccgactctaag
gaaatgtacgaagcttggattgctgcgcttcaaaagggcataggtgcagcttttcaacgc
atacatagtattgaatgtagtaataatgccagtgggcaatcgaatcattctaacgacgaa
caaagcggacattccgtcgccaattacaataataataaaattaagaaaataagaatgtgg
gagcaacttttgaaaatccccggcaacaactactgttgcgactgcggcagtgccaacccg
cactgggcgagcataaacctgggcataaccctctgcatagaatgctcgggggttcaccga
agtctgggcgtccactacagcaaagtccgctctctaaccctcgacgactgggaaccggaa
atcatcaaagtgatggtcgaactgggcaacaccatcgtaaaccaaatctacgaggcccaa
gttccggacgatttcgtccgcgccactccagactgtcccggaacaatccgggagtcgtgg
atcaaggcgaaatacgtcgataaaaaattcgtcaagaatttgccacatttcgacagtcaa
cagcgcacctcgcgggccagtttgatggaaatccggaagtggagtgtccggaaaatccgg
cgacggccccggagctgcgataatgcgaaacgaagggctaaaacacagtttaagtcacag
gaggatgtttcgagagatcgtatttcggagactagtgagagtagcgaagcggagacgggg
aatcggggggttttgctgtttggcgatttggataagcagccgctagatggcacgattgat
ttgagtagtgaccaggagtcgacggctggggagggggaggacacggtcgaggaggaagat
atagataaacttcacccgaatttgctgctttataaagccgcggttgcgcataatttgccg
gttatgtgcgaggctcttgctttaggggccgataaacagtggattaatctcgaggatagg
gggcgcagtccgatacatcaagcgattttaagtgggtcggtaatgccttgcgcttacttg
attctgaacggtgctaaaatcaacgcccaggaccaaaacggcaaaacgccgctgcatctc
gcgacacaggaagggcacacggcccaggtttgtcttttgttgaaacacagggccgaccag
cacctggaggacgacgaggggaaggtccctttgcagatggcggagcagaaggagcacgcg
gacattgtcactctgttgcgcttagggcgtctcaacgacgagatgaaggaatccgagaac
ggattaacaggcgacagtatgtttaacgacgttgttagggatttttcgcaacttgcgtgc
tcgcatcctgagagactacaacgacagaaaatcgacaacaaatga

DBGET integrated database retrieval system