KEGG   Tribolium castaneum (red flour beetle): 664324
Entry
664324            CDS       T01046                                 
Name
(RefSeq) dynein heavy chain 1, axonemal
  KO
K10408  dynein axonemal heavy chain
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:tca03037]
    664324
   04812 Cytoskeleton proteins [BR:tca04812]
    664324
Cilium and associated proteins [BR:tca03037]
 Motile cilia and associated proteins
  Dynein arm
   664324
Cytoskeleton proteins [BR:tca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     664324
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 MT AAA_lid_11 Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA AAA_18 Sigma54_activat
Other DBs
NCBI-GeneID: 664324
NCBI-ProteinID: XP_015834565
Position
LG4:complement(3442347..3462573)
AA seq 4161 aa
MHQSDKLSTDRQSVAKDGKTVIERPKRATRGYYSEIITSEDYGRDVDAEGLIGCSRKTNY
LWQVKTEKHAPTVFKFQSPRQKLDLKDAERWMTFDEDELIEFSVDTFKPKVQLQQTVYPF
EMTRSVATERLRRSFQAKNIQLLLEKLDIEPAHMVSVQLLEQYYPNKVPHVNIITNYLPL
ELFDDEEYDCRTPENWLELGIVKGVRNPLPGEAFVPVESYVLEPFTRLNDLFAHLGQWVN
VAVQDYNPETKLWKILTLDGTRRSFELPRIYVMFKAEDPSVFAQRIKAAVDLRRETEATL
RYKFYLNTMLLVEIPELDDDLIDRIYYSATRNNFIKEATSWSKLVKQVQFSYQQTHCDLQ
FRRDAEKDARLKPYVEVTAKGWDDPLKIVAKIKTGMKSFSGMCEYFRWMNIYVIPETYRA
MFLVVGECLKIEQMSLFTKSYGIKHITLEEFDTVQSQCTNNVIKHMQGQWVETVVYNIRM
CLGDVGKGWFDITVYNHEVYEVSKLKRFMELVKFRMQYTLRVLVLHSIEVYIDLIETPCL
PCLEVDDDFVWGSNLIESPFVSRASAIFILQLKMDENSAFYSTNLEQFEKVLLRLYDTAL
TFTHKIKQVHPFLLKNLNFPHDLMLSSIGLLADEVVSVRERFLLAYKKALIPLRAFAKEF
DIHIELFILDVKDYVERFKNDQHTASEVKEEVSFHLRMKANLEATLPTTIIIGPFFITIE
QLRHFLISKRQELATKLLDMFCLRMRNCILDVLEEYTRISEKLNEKPDNIENVFEIREWM
ETIPMLVRAQEDLVRRYVIEYDVLEHFWYALPQEDFENKWEAVGWPYKLAKQVEQTEQYL
KEEEEKFYKIQLNDEYNLQEKIEGFTAQVVKMAKEKDFSRTHEIAVDMRRLWKALKEAQE
QGQLLNQRQKLFNIPVVPFDNLLKLIKEFEPYKTLWITASDWLRAYEMWMDNPLVNIDSE
AIERLVTDMYKTMVKSVRVFAEIEAVQEVALEVKRQIEEFKPLIPLLLSLRNPGMRQRHW
DKFKEETGINIVWTPATTFKDCLDLGVAEYTERLVGIADESSKEYAVEQTLEKMMNEWEN
CTMELTPYKDTGTYIMKIPEETQQMLDDHLVLTQQVSFSPFKGPFEQMIDQWEENLKITS
DVIEEWMDVQKQWMYLEPILTSEDIRIQLPAESKKYGSMERTWRRIMRGARDNPYILKYC
ADRKLYESLKDANHILDIVQKGLADYLETKRMVFPRLYFLSDDELLEILSHAKNPLAVQP
HLRKCFENIARLNFESDLCITQMFSAEDECVSLNPTLYPTANVENWLLLVESSMRNTIRT
ILGDSLKEINDKPRDVWVLEWPGQVVIAGSQTFWTAGVEHGIGGNTLNDFLENVVFTNLD
ALRGLVKGSLSFLHREILSALIVIEVHARDVTQKLVDLSITNVNDFDWISQLRYYWVEPD
LKVRAVNAEFQYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETT
KDLAKAMALQCVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQIT
TIQKAQQARLDVFIFEGSEIKLKESCAVFITMNPGYAGRTELPDNLKALFRPVSMMVPDY
SLISEISLFSFGFSNAKLLANKITTTFKLSSEQLSTQDHYDFGMRAVKTVIAVAGNLKRE
KPEMNESQIVLRALRDVNVPKFLKDDLKLFNGIVSDLFPKMVEEPVDYGVLEESIRASCI
KMGLEDVNEFVRKVIQLYETTIVRHGLMLVGPTASGKTKCYEVLKAAMTALDGQPQPSGQ
PFRPVHTYVMNPKSITMGQLYGEFDLQTHEWTDGILPCLVRIGVAAENKDKRWYVFDGPV
DAVWIENMNTVLDDNKKLCLSSGEIIKLRDTMTMMFEVADLAVASPATVSRCGMVYLEPG
VLGLAPFINCWLKRLPKLAAPFADKFKELIYAYVVPGIELVRNRLREILTSVDSALLYKF
LRLMDYWLLPLSGRDNKPPPGPQFLALIPELLAPWVIFSMIWSIGCTCDNRSRVRFDHWL
RGKMLEEGDEPYFPQKGLVYDYRLHDGGFTDPTEDGNPMPPHWYSWMDNVEEFKITVDMK
YSDMEVPTMDTVRNAKMLEIVLNNYDNVLCVGPTGTGKSLTVVGKLSRSMHKKFICDFMS
FSARTSANQTQDLLDSKLDRRRKGVFGPPVLKRQIFFIDDFNMPALEVYGAQPPIELIRQ
WMDFGGWYDRKNIGDFRTIIDTNFCVAMGPPEGGRNPVTARLLRHFHYLAFIEMEDDSKR
KIFGTIFKFWMERIPEEFTLGHFYEPILEATLNVYSTILKELLPTPAKTHYTFNLRDLSK
VFQGLLMFNPEKMTDINLLVRLWYHECCRIFQDRLVNDDDRNWFANLLKNKIESEFEVDP
VSALGTQMLFFADFIDPTTDYREYEQITDSARLSNVLDYYLNEYNEQSTRPMKLVLFLDA
ISHVCRISRIIRQPLGNALLLGVGGSGRQSLTRLATFMAEYVCFQIEIHKTYGMFEWRED
IKGLMLKAGLHRRETVFLFSDTQIKSESFLEDLNNVLNSGDVPNIYQPDELDKIFQEMRG
VVQEMGLVATKSNLFATYQKVVRANLHTVVTMSPIGDIFRARLRQFPALVNCCTIDWFSE
WPDSALRSVAFQFLDDMAELDVGQEVLHGIVMVCQFMHASVVDASILYKQELSRHNYVTP
TSYLELLSSYTDLMLKKRGALSEGITRLSTGLDKLKSTAEEVKILQASLEEMKPALEAAK
QDAETMIAEIAKDQIIAEETKEIVEKEELEAAKKALETQTIADDAQRDLDEAMPDLLAAE
ASLKSLNKNDISEVRSMKRPPAGVVYVIESICIIKNIKPAKLPGRMPGEKVLDYWEPGRN
MLADPGVFLTSLMNFDKESITEEMIDKLKNYVSNPQFQPAKVAKVSKACKSFCMWVHAMY
KYYFVNKRVAPKKAALAQAKAELAKTEAALAAAKAKMQAVLDNLRLLQEKLGAKIAFKEE
KEASIQICLERMSRAVRLINGLSDERVRWLNTISSIEASVVNVTGDILLSAGAVAYLTPF
TDKYRRGLLSEWLKEIKEQKIPCSADPNPVSVLAEPVQIRAWQLDGLPRDYFSTENAVLV
SNSKRWPLFIDPQGQANKWVKNMERAQGLAVCKMADKELLRTLESAVRFGKPVLIEGVGI
DLDPSLDPVLLRQKFKQAGTWMLKLGEVVVPYDDDFHLYMTTKLPNPHYTPEVSVKVLLV
NFTLVPSGLQDQLLALVVMQERPDLEDQRSQLIVGSTQMKQELKEIEDRILYKLSSLEGS
PLDDLDFIITLEASKVKSDDIKNKVVAAEITQIDIDNTRALYIPVANRAQILFFCLSDLS
NVDPMYQYSLEWFVGIFIASMAETERTENIDERVVIINEYFTFSLYSNVCRSLFEKHKLH
FAFLMCARIFMDMGKIDGHEWHHFLAGGTPLSEDPNPAPDWLSGKAWKEILAMRVLPNYV
RFVDTFAQYKEDYRVIFESGDPHRKPLPEEFEKSFSEFQKLLVLKCLRPDKVTNAMQDFI
SSKMGQRFIEPQTTDLSVVFKDSGPTTPLIFVLSTGTDPAADLYKFADKMKFAKRMFSIS
LGQGQGPIAEKMLHNGTELGSWIFFQNCHLAPSWMPRLERLVENISPEIVHRDFRIWLTS
TPSPHFPVSILQNGSKMTIEPPAGIKANIMRAYTNQVSDLIDILHGDGPKNFNFKWLLFS
LCLFHGVLLERRKFGPLGFNIPYEFTDGDLKICISQLRMFLWEYDEIPFKVLTYTAGHIN
YGGRVTDDWDRRCLMNILADYYKPEVVNADYVFDAHGFYHQMPAETPYYDYLDYIKHFPI
NDDPELFGMHPNADISFAQAQTYSCLSTLLTLQPRQVGGAAASEEEVIAQTAASILNHLP
RQFDLEAISEKYPVLYEESLNTVLIQEGIRFNRLLKAIESSLKDLLKAIKGLVVMSEALD
KMATSLFSNIVPALWSSKAYPSLKPLGAWVADLDARVKFLNTWVDQGIPSVFWISGFYFP
QAFLTATLQNFARKYVVSIDTINFSFKVLEHAPAKRPDDGCCIWGLFVEGARWNSSVGTL
DESHPKELYTEMPVVWLLPEENHVKPEGRYECPVYKTLTRAGVLSTTGHSTNYVLAIEVP
SKKSEAHWIKRGVALICALDY
NT seq 12486 nt   +upstreamnt  +downstreamnt
atgcatcagtctgataaattgtcgactgatcgtcaatcagtggcaaaagatggaaaaacg
gtgatagagcgccccaaaagggcaacacggggctattattcggaaattataacgagtgaa
gactacgggcgcgacgtggatgccgagggcttgatcggttgctcgcgcaaaacgaattac
ttatggcaagtcaagaccgaaaagcacgccccaactgtgttcaaatttcaatcgccgaga
caaaaactcgacttgaaagacgccgaaaggtggatgacgttcgatgaggatgagctcatt
gagttctctgtcgatactttcaagccgaaagtgcagctgcagcaaactgtttaccccttt
gagatgaccaggagtgtagctaccgagcggctacgcaggtctttccaggccaaaaatatc
caacttttgctcgaaaaactggatattgaaccagcccacatggtctcagtgcagcttttg
gaacaatactaccccaataaagttcctcacgttaacatcatcacgaattacctgccgttg
gagctattcgacgacgaggaatacgactgcaggacaccggaaaactggctagaattggga
atcgtcaaaggtgtgcgcaatccccttcccggcgaagctttcgtacctgttgaatcctac
gttttggagcctttcacgcgcctcaacgatcttttcgcccatttgggacaatgggtgaac
gtcgccgtccaggactacaatcccgagaccaagctttggaaaattttaactcttgatggc
acccgaagatcgttcgaattacctcggatttatgtcatgtttaaagctgaagatccttca
gtttttgcacagagaattaaagcagccgtggatttacgacgagagactgaagcaacatta
agatacaaattttatttaaatacgatgcttcttgtggaaatacctgaactggacgacgat
ttaatagacagaatctactattcagcgactagaaacaatttcataaaagaagcgacctcg
tggtcgaagctcgttaagcaagttcagttttcttatcagcaaacacattgcgatcttcaa
ttcagaagagacgcagagaaagacgcgagattaaagccgtatgtcgaagtgacggcaaaa
ggatgggatgatcctcttaagattgttgctaaaattaaaactggtatgaagtcgttttcg
ggaatgtgtgaatatttcagatggatgaacatttatgtgattcctgagacgtatcgcgcc
atgtttttggtagttggagaatgtttaaaaatcgagcaaatgtccctgtttactaaaagt
tacggaatcaagcatatcacacttgaagagttcgacacggtgcaatctcagtgcactaac
aatgtcatcaaacatatgcaaggacagtgggttgaaacggtcgtttataatataagaatg
tgtttaggggacgtgggtaaaggttggtttgacatcaccgtttacaaccacgaagtatat
gaagtgtccaagttgaaaaggttcatggaattagttaaattccggatgcagtacactctc
agagttctagttcttcattccatcgaagtgtatatcgatttgattgagactccgtgcttg
ccgtgtctcgaagttgacgatgatttcgtctgggggtcaaacctaattgaaagtcctttc
gtgtctagagcttcggcaattttcatattacaattaaaaatggacgaaaactctgctttt
tactcaacgaatttggaacaattcgagaaagttttgctcagattatacgacacggcactg
actttcacgcacaaaatcaaacaggtgcatccgtttctactgaagaatttaaattttccg
catgatttaatgctgtcgtcgattggtttactggcagacgaggtggttagtgtcagggag
agatttcttctagcttacaagaaggcgctaatacctttaagagcatttgccaaggaattt
gatatccacattgagctttttatcctcgatgtcaaagactacgtcgaacgatttaaaaat
gaccaacacacggcgtccgaagttaaagaagaagtttcctttcatttaagaatgaaagcg
aatctggaggctactttaccgacgactataatcataggcccgttttttatcacaattgag
cagttgaggcactttctgattagtaaacgccaagaacttgcgactaaacttttggatatg
ttctgtctaagaatgagaaattgtatactggacgttctcgaggaatatactcgaataagc
gagaaactgaatgagaaaccggataatattgagaacgttttcgagatacgggaatggatg
gagaccattccgatgttggtcagggctcaggaagatttggttcgccgatacgtaatcgaa
tatgacgttttggagcacttttggtacgctcttcctcaggaagatttcgaaaataaatgg
gaagctgtcggttggccgtacaaactcgcaaaacaggtggaacaaaccgagcaatatctc
aaagaagaagaggagaagttctacaagattcaactgaacgacgagtataaccttcaagag
aaaatcgaaggttttaccgcacaagttgtcaaaatggccaaagagaaggacttttccagg
actcacgaaatcgccgtcgatatgcgtcggctgtggaaggccttgaaagaggcgcaagaa
caaggacaacttttgaatcaaagacaaaaactctttaacatcccagttgttccgtttgat
aatctcttaaagttgatcaaggagtttgaaccgtacaaaacactctggattacggcgtcg
gattggttaagagcgtacgaaatgtggatggataatcctctcgttaatatagatagtgaa
gcaatcgagagattggtcacagatatgtacaaaaccatggtcaagtcagtccgagttttt
gccgaaattgaagcggtccaagaagtagcactggaagtaaaaagacagatcgaggagttc
aaacctttgattcccctcttattgagtctgagaaacccggggatgaggcaaagacattgg
gataaatttaaagaagagactggtattaacatagtttggactcctgcaaccacgtttaag
gattgtcttgacttgggagtggcggaatacaccgaaagattagtgggaatcgccgatgag
tcaagcaaggagtatgcagtcgaacaaacgttagagaaaatgatgaacgagtgggagaac
tgcactatggagttaacaccgtataaagacaccgggacgtatattatgaaaatccccgag
gagacgcaacagatgctcgatgaccatctcgttttgactcaacaggtcagtttcagtccg
tttaaaggacccttcgagcagatgatcgaccagtgggaggaaaatcttaagatcacatcg
gacgtcatcgaggaatggatggacgtgcaaaagcaatggatgtatttagaacccatccta
acaagtgaagatatcagaatacaacttccggcggaaagtaaaaagtacggttcgatggaa
cgaacctggcgtcgcattatgagaggagctcgagataatccatacatactgaaatattgc
gccgaccggaaactgtacgagagtctcaaagacgctaatcatatcttagatatcgtccag
aaaggacttgccgattatttggaaaccaaacgaatggtattcccccgattgtacttcctg
agtgacgatgaattgttggagattctctcgcacgctaagaatccattggccgtgcaacct
catttgcgtaaatgtttcgagaatatagcgagattgaacttcgagtcggatctgtgtatc
acacagatgttttcggccgaagatgagtgcgttagcctcaacccgacgctctaccccact
gccaacgtcgaaaattggttacttctcgtggaatcaagtatgagaaatacgatacgaacg
atccttggagattcattgaaagaaatcaatgataaaccgagagacgtgtgggtccttgag
tggccaggccaggtggtcattgccgggagtcaaaccttttggactgccggcgtcgaacac
ggaattgggggaaataccctaaatgattttctcgaaaatgtcgttttcactaacttggac
gcgcttcgcggtttggtcaaaggttcattgtctttcctccaccgggagattctctcagct
ttgattgttattgaagtacacgcacgtgacgttactcaaaaactggtcgacttgagtatc
acaaacgtgaacgattttgattggataagtcagttgagatattactgggtagagcctgat
cttaaagttcgggcggttaatgccgaatttcaatacggttacgaatatttgggcaatagc
ggtcgcttggttataactcctttaaccgatcgctgttacttaactttaacaggggctctc
catttgaaatttggcggagctccggccggcccagccggtaccggaaaaaccgaaaccacc
aaagatttggcaaaagcaatggctctacagtgtgttgtttttaactgttcggaccagtta
gatttcatggcgatgggtaaatttttcaaagggttggccagttccggcgcttgggcgtgc
ttcgacgagtttaatcgaattgatattgaagtgttatcagtcgttgcacaacaaatcacg
actatacagaaagcgcaacaggcgcgtctcgacgtttttattttcgaaggatccgaaatt
aaattaaaggagtcttgcgccgttttcataactatgaatccgggttatgccggccgaact
gaactaccggataatttgaaagctctcttccgacccgtttcaatgatggtcccggattat
agcttaatttccgaaatttcgctcttttcatttgggtttagtaacgcgaagttgttggcg
aataaaataaccacaacttttaaattgagttcggaacaattgagtacacaggatcattac
gatttcgggatgagagccgtcaaaactgtgatagcggtggctgggaatttgaaacgagag
aaaccagaaatgaacgagagtcaaattgtgttgagagcgttgcgggatgtaaacgttccc
aagtttttgaaggacgaccttaaactgttcaatggaatagtttcggacttgtttccgaaa
atggtggaggagccggtcgattacggcgtgctggaggaatcgatccgcgcgtcttgcatc
aagatgggattggaagacgtgaacgaatttgtccggaaagtgattcaattatacgagact
acgatagtccgacatggattaatgctggtgggaccgacggcgtccgggaaaacaaagtgc
tacgaagtgttgaaagctgcgatgacggcgctcgatgggcagccccagcccagcggccaa
ccattccgtcctgtgcacacctacgtcatgaaccccaaatccatcacaatgggccaatta
tacggcgagtttgatttgcagactcacgaatggacggacgggattctcccgtgtttggtg
cgcattggagtggctgcggagaacaaagacaagcgttggtacgttttcgacgggcccgtg
gacgctgtctggatcgaaaacatgaataccgtccttgacgataataaaaaattgtgcttg
agcagcggcgaaataatcaaactgcgagatacaatgacgatgatgtttgaagttgcagat
ttagctgtagcttctccggcgactgtctcccgatgcgggatggtttacctcgagccggga
gttttgggattagcgccgtttatcaactgttggttgaaacgactcccaaagctggcggcg
cctttcgccgacaaattcaaagagttgatttatgcatatgtggtgccagggattgaacta
gtccgtaaccggcttagggagatcttgacttctgttgattcggcccttttgtacaaattt
ctacgtttgatggattactggcttttgccgttatcggggcgtgataataaaccgccccca
ggaccacagtttttagctttgattcccgagcttttggctccttgggtcattttttcgatg
atttggagcatcggctgcacttgcgataaccggagtcgcgtacgtttcgaccattggctc
aggggaaaaatgctagaggaaggagatgagccgtactttccccagaaaggtctggtgtac
gattatagattgcacgatggtgggtttactgaccctacggaggatggaaatcccatgcca
ccgcactggtacagctggatggacaatgtggaagaatttaaaatcacagtggacatgaaa
tattccgatatggaagttccgactatggatactgtacgaaacgccaaaatgttggaaata
gttttgaacaactacgataatgtgttatgtgtcggcccaacgggaactggaaaatctctc
acagttgtcggaaagttgagccgaagtatgcacaagaagtttatttgcgattttatgagt
ttctcagcgaggacttcggctaatcaaacccaggatttgctcgattcaaaactcgatcga
cgaagaaaaggcgtgtttggacctccggtcttaaaacgccagatctttttcattgatgat
tttaacatgccggctttagaagtgtacggtgcccaaccacccatcgaactaattcgtcaa
tggatggattttggaggttggtatgaccggaaaaacatcggcgactttcgcacaattatt
gatacgaatttttgtgtcgcgatgggaccccctgaagggggcagaaacccggtcacggct
agattattgagacatttccattatttggccttcatcgaaatggaggatgatagtaagagg
aaaattttcggaacaatttttaaattttggatggagcggataccggaagagtttaccttg
gggcatttttacgaaccgattctggaagcaacacttaatgtttatagcacgattttaaaa
gaactgcttcctacgccagcaaaaacgcactatacttttaatttgcgggatttgagtaag
gtttttcaagggttgctaatgtttaatcctgaaaaaatgacggacataaatttattggtg
cggttgtggtaccacgagtgttgtcgcattttccaagaccgattagtgaacgacgacgac
agaaactggtttgcaaatttgctcaaaaataaaatcgagagtgagtttgaagttgatcct
gtttcggccttagggactcagatgttgttttttgccgattttattgatccaacgactgat
tatcgcgaatatgaacaaattactgattcagcacggttatcaaacgtccttgattactat
ttgaacgagtataacgagcagagcacgcgtccgatgaagctggtccttttcctggatgca
atttcgcacgtttgtcgcatttcgaggatcattcggcagccactaggcaatgcacttctg
ttgggtgtaggcggatccggacgacagagtctgacgagacttgcgacctttatggcggag
tacgtttgtttccagattgaaattcacaaaacttacggcatgtttgaatggcgcgaggac
atcaaaggactaatgcttaaagccggtcttcacagacgcgaaactgtttttcttttctca
gacacacaaattaaatccgagtcgttcctagaagacttaaataatgtactaaattccgga
gacgtcccgaatatttatcaaccggacgaattggataagattttccaagaaatgagagga
gtcgtgcaagaaatgggactcgtggcaacaaaatctaatttatttgccacttatcagaaa
gtagtgagagcaaatttgcacacagtggtcacaatgagtccgataggtgatattttccgg
gcaagactacgacagtttccggctttagtcaattgttgcacgatcgactggtttagcgaa
tggccagattcagcccttaggtcggtagcgttccaatttttggatgacatggctgaatta
gacgtaggacaagaagtcttgcatggaattgtcatggtgtgtcaattcatgcatgcaagt
gttgtcgatgcgagcattctttacaagcaagagctttcgagacataattatgtcacgcca
acgtcttatctcgaacttttgtcaagctatactgacctcatgttgaaaaaaagaggagct
ttatcggagggcattacgagattgtcaaccggcttggataagctcaaaagcactgccgaa
gaagtaaagatccttcaggccagccttgaagaaatgaaaccggccttggaagccgcaaaa
caagacgccgaaacaatgattgctgaaatcgccaaagatcaaatcatcgcagaagagacg
aaagaaattgtcgaaaaggaagagctcgaggcggccaaaaaagctctcgaaacccaaaca
atcgccgatgacgctcaacgagatttagatgaggcaatgccggatctgttagcggccgaa
gctagtttaaaatcgcttaataaaaacgatatttccgaagtgcgatcgatgaagcgtccg
ccggccggcgtagtatacgtcattgaatcgatttgcatcattaaaaacatcaaaccggcg
aaattacccggaagaatgcccggagagaaagttttagactactgggagccgggtcgcaac
atgctcgctgatccgggcgtgtttctaacgtcgttaatgaactttgacaaagaatcaatc
accgaggaaatgatcgacaagctgaaaaattacgtatcgaatccacaatttcagcctgca
aaagtggccaaggtctctaaagcgtgcaaatcgttctgtatgtgggttcatgcaatgtat
aaatactactttgtaaataagcgagtggcgccgaagaaggccgccttggcacaggcgaaa
gccgagttggccaaaaccgaagccgctttagccgcagccaaggcaaaaatgcaagcggtt
ttggataatttaagattgttgcaagaaaaattaggggcgaaaattgctttcaaagaggag
aaagaagcgagtattcaaatttgtttggaacggatgagtcgagcagttcgcctaatcaat
ggattatccgatgagagagttcgctggttgaacaccatttcgagcattgaagcaagtgtt
gtcaatgtcacgggtgatatactcctgagtgccggtgctgtggcttatctcaccccattt
acggataaatacagacgagggttgttgtccgaatggctcaaagagataaaggagcaaaag
ataccctgttcggctgatcctaatccggtttcggttttagccgaaccggtccagatacgc
gcatggcaattggacggcttaccgagggattatttctcaacggagaacgctgttctcgtt
tcgaattcgaaacgttggcctttgtttatagatccacagggacaggccaataaatgggtt
aagaatatggaaagggctcaaggattggcggtgtgtaaaatggccgataaggagctgttg
cgtactttagagtcggcggttaggtttggtaaaccagttttgattgagggagtcggaatt
gatttagatccgtctctggatccagttttactgcgccaaaaatttaaacaggcaggaacg
tggatgttgaagctgggtgaagtcgtcgtgccttacgatgacgattttcatttatacatg
acaacgaaattaccgaatccgcattatacgcctgaagtttcagttaaggttcttttggtg
aattttactctggtcccgagtggcttgcaggaccagctgctggctttagttgtcatgcag
gagcgtcccgatttggaggaccagagaagtcagttgattgtcggaagtacacagatgaaa
caggaattgaaggaaattgaagacaggattttgtacaagttgagttcattggaaggttca
cctttggatgatttagattttataataacactcgaagcatcgaaagttaagagcgacgat
attaaaaataaagtggtcgctgctgaaataacacaaatcgacatcgacaatacacgtgcc
ttgtacattcccgtagcaaatagggcacagatattgtttttctgtttgtccgatttatca
aacgtcgaccctatgtatcaatactcgttggagtggttcgttggtattttcatagcaagc
atggccgagacggaacgaaccgaaaatattgatgaaagagttgtcataatcaacgaatac
tttacgttcagtttgtatagtaatgtttgtcgcagtttgtttgaaaaacacaaattacat
tttgcgtttttgatgtgcgcccggatatttatggacatggggaaaattgacgggcacgaa
tggcatcactttttggcaggaggcacccctctctcggaagatccaaatcccgcgcctgat
tggctctcgggcaaagcatggaaggaaatcctcgcaatgcgtgtccttccaaattacgtt
cgattcgtcgatactttcgcacaatacaaagaagattatcgcgtcatatttgagtctggg
gaccctcacagaaaaccgttacccgaagagttcgaaaaatcattctccgagtttcaaaag
ctattagttttgaagtgtttgcgtcccgacaaagtgacaaacgccatgcaagatttcatt
tcgtccaaaatgggtcagagatttatcgaaccacagacgaccgacttatccgtcgtcttc
aaagactccgggcctacaacccctttgattttcgtcctgtccactggaacggatccggcc
gcagatctgtacaagttcgcagacaagatgaaattcgccaagagaatgttttcgatctcg
ctgggccaaggccaaggacccattgccgagaaaatgctacacaacgggactgaactcggc
tcgtggattttcttccagaactgtcacctggcgcccagttggatgccgcggttggaacgt
ctagtggagaatatttcgccggaaattgtgcatcgggattttagaatttggttgacgtcg
acgccgtcgccgcatttcccggtttcgattttacaaaacgggagtaagatgacgatcgag
ccgccggcggggattaaagccaacataatgcgtgcttatacgaatcaagtgtctgatttg
atcgatatcctgcacggcgatggcccgaaaaatttcaatttcaagtggttattgttctcg
ttgtgtctcttccacggcgttttgctcgaaaggcgcaaattcgggccgttgggattcaat
atcccttatgaatttacagacggcgatctgaaaatttgcatctcgcaactgaggatgttc
ctgtgggagtatgacgaaattcctttcaaagttttgacatacacggcgggtcacatcaat
tacgggggaagggtgacggatgactgggatagaaggtgtctgatgaatattttagccgat
tattacaaaccggaagttgtcaatgcggattacgtctttgatgcgcacgggttttaccac
caaatgccggcggaaacgccatattatgattacttggattatatcaaacattttccgatt
aacgatgatccggaattgttcgggatgcatcctaatgctgatatatcgttcgcacaagca
cagacttatagttgcttgtcaactctgttgacgctccagccgagacaagttggaggtgca
gctgcgagcgaggaggaagtcattgcacaaacggcagcttctatacttaatcatttgccg
agacaattcgatttggaagcgatttcggagaaatatcccgtcctgtacgaagaatcttta
aacacggttttaatccaagaaggaatccgctttaatcgcctgctcaaagcaatagaaagc
agcctcaaagacctgcttaaggccatcaaagggctcgtcgtaatgtctgaagcacttgat
aaaatggcgactagtttattcagcaacatcgtcccagccctctggtctagtaaagcctac
ccttcactcaaacccttaggcgcttgggtcgccgacttagacgcccgtgtcaagttttta
aacacgtgggtcgaccaaggcatcccttcagtcttctggatttcgggtttctacttccct
caagctttccttactgcgactttgcagaatttcgctcgaaaatatgtcgtatcgattgat
acgattaacttttcgtttaaggttctcgaacatgcgcctgcaaaacgaccggatgacgga
tgttgtatatgggggctgtttgtggaaggcgcgaggtggaacagttcggtggggacttta
gatgagtcgcacccgaaagaattatatactgaaatgccggtggtttggttactaccggag
gaaaatcatgtcaaacccgaaggcagatatgagtgtccggtttataagactttgacaagg
gctggggttttgtcaactaccggacattcgacgaattatgttttggcgattgaagtgccg
agtaaaaaatcggaagcgcattggatcaaaagaggagtggcactaatttgtgcactggat
tattaa

DBGET integrated database retrieval system