KEGG   Tribolium castaneum (red flour beetle): 664443
Entry
664443            CDS       T01046                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit beta-5
  KO
K04539  guanine nucleotide-binding protein subunit beta-5
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    664443
   04031 GTP-binding proteins [BR:tca04031]
    664443
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   664443
GTP-binding proteins [BR:tca04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    664443
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like
Other DBs
NCBI-GeneID: 664443
NCBI-ProteinID: XP_975542
UniProt: D6WR87
Position
LG7
AA seq 353 aa
MTETESKDCPTETIESLTKEAEALKKKLEDERQKLNDVTLATVAERLDIINYMNIKPRRT
LKGHQAKVLCSDWSPDKRHIVSSSQDGKMIIWDAFTTNKEHAVTMPTTWVMACAYAPSGN
LVACGGLDNKVTVYPLSLDEDVTLKKKTVGTHTSYMSCCIFPNSDQQILTGSGDSTCALW
DVESGQLLQSFHGHSADVMSIDLAPSETGNTFVSGSCDKMVLIWDMRSGQCVQSFEGHES
DVNSVKFHPSGDAVATGSDDATCRLFDLRADKEVAVYSKESIIFGVNSVDFSVSGRLLFA
GYNDYTVNVWDTLKCVRVCLLYGHENRVSCLQVSPDGTALSTGSWDYTLRVWA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaccgaaacggagtcgaaagactgtcccactgaaaccatcgagtccctcaccaaagag
gccgaagccttgaaaaagaaactggaagatgagagacaaaaactcaacgacgttacactg
gctacggtggccgagcgcttggacatcatcaactacatgaacatcaaaccccgacgaacc
ctaaagggccaccaagccaaagtcctgtgttccgattggtccccggacaagcgccacatt
gtctcatcatcacaagatggtaaaatgatcatttgggacgctttcactactaacaaagag
catgcagtcaccatgcctacaacttgggtaatggcttgtgcttacgccccatcaggaaac
ctagtcgcttgcggggggttggataacaaagtcactgtttatcctctaagtctggacgag
gatgtgaccctcaaaaaaaaaacagtcgggacgcacactagttacatgagttgttgcatt
tttcccaactctgaccagcaaattttgacggggagtggcgactcaacttgcgctttgtgg
gacgtagagtcgggccagctactgcagagcttccacggacattccgctgatgttatgtcg
atagatttggccccgtctgagaccggcaacactttcgtctccgggagttgcgacaaaatg
gtattgatctgggacatgcgttcgggacaatgcgtccaatcttttgaaggacacgaatcg
gacgttaacagcgttaaattccatccaagtggcgacgctgtagctacaggaagtgacgat
gctacgtgtcggttatttgatctaagggctgacaaagaggttgcagtttacagcaaagaa
agtattatttttggggtgaattcggtcgatttctccgtttcaggtcgactcttattcgct
gggtataacgattatactgtcaatgtttgggatactcttaaatgtgtaagagtgtgtctg
ttgtacgggcacgaaaatcgagtctcgtgtttgcaagtctcgccagatggcactgctctt
tctacagggtcgtgggactacacccttagggtctgggcttaa

DBGET integrated database retrieval system