KEGG   Tribolium castaneum (red flour beetle): 664545
Entry
664545            CDS       T01046                                 
Symbol
Fas-2
Name
(RefSeq) fasciclin-2
  KO
K06491  neural cell adhesion molecule
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    664545 (Fas-2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tca04515]
    664545 (Fas-2)
   04090 CD molecules [BR:tca04090]
    664545 (Fas-2)
   00536 Glycosaminoglycan binding proteins [BR:tca00536]
    664545 (Fas-2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tca00537]
    664545 (Fas-2)
Membrane trafficking [BR:tca04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    664545 (Fas-2)
Cell adhesion molecules [BR:tca04515]
 Immunoglobulin superfamily
  NCAM1/2
   664545 (Fas-2)
CD molecules [BR:tca04090]
 Proteins
  664545 (Fas-2)
Glycosaminoglycan binding proteins [BR:tca00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   664545 (Fas-2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tca00537]
 Others
  664545 (Fas-2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set
Other DBs
NCBI-GeneID: 664545
NCBI-ProteinID: XP_008192342
Position
LG4:complement(6814234..6879634)
AA seq 870 aa
MLCRVAFFVFVAIITAALADRQPQLTIQPSTPVVSKEVGGKLALTCAPDVEESSLISQLE
WRDSKNRRIESTNNGKKTFSQSNGRDLILFFQELQERDAGNYTCVANYGSETLKSTVVVN
TYVDITFVNAPESQYPKVGEDYLVRCKVHGNPTPIVEWSKKDNKIESNEKYVIQSDGLLI
KNPTEADDGSYTCRAYAVSTGGFKERVIKLEVIIPPVIKDMEPVSVIEGEQAWTKCEATG
KPPPTYSWIKQRNSQDLSKSDRFTVKQTTGNLLISKVEFNDDDFYKCTAENKAGRAEKTV
KINVLVKPKIFELLNVTAPVHQETKIICKARGRPTPKVYFRKVSDKEHPFRVGQQRDPRI
ILEEQMFEKTGETFGTLIISNLNRSDDGLYECIAENSAGTGYKNGHITVEFPPTFERTKL
LEPIAWTWLNHPGNLTCIPEAIPNATVVWKHNGYIINPGNPPFKIQGFGPTSHLIVDAFN
DPRFYGEYECLATNKLGKATHSITLKEAQVPANVDKVQIQTLTATTIKFNIVPPQYFDTL
PIRSFTVQYKPEGEIGWSRARNRTWSFRAPYILENLVPEVTYNFRFAAANDVGFGPWTNA
PTVTMPRRSEPAEPKIYVPNHILDNSSNRQDVVAVSPYADHFELRWQVPNDNGDPIDVYL
IRYCVITKINGEWRDSDCSEEIQQTFKSTTYDLNSLKPDTFYKIELRAHNSIGSSSPAQI
KVKTARGIDPAVPYNEPSVTNFAIIGIVVGAVILVLILVDLICFCVNRAGILAFICDRNR
SKHHEEDPKLGSLYSWRFPLPYCSYKAAPAHPNSLNLPLPVKLAPSPMEEEREPLKDAHM
NGGEKTMSVEFDGKHVYSKSGEIIGKHSAV
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgctgtgtcgggtggcgttttttgtctttgttgccatcattacagcggcgcttgctgac
agacaaccgcaattgaccatccagcccagcacaccagtcgtttccaaagaagttggaggc
aagctagccttaacatgtgcacctgacgtggaagaatcaagtctcatctcccagttggaa
tggagggattcaaaaaaccgtagaatagagtccaccaataacgggaaaaagactttttca
cagagtaacgggcgcgacctaatcctcttcttccaagaattacaagagcgagatgcgggc
aactacacttgtgtcgccaattacggcagtgagaccttgaaatcaaccgtggtggtcaac
acttacgttgatatcacgtttgtgaacgctcctgagtcccagtaccccaaagtcggggag
gactacctcgttaggtgtaaagtccacgggaaccccacaccgatcgtcgagtggtcgaag
aaagacaataagattgaatcgaacgaaaagtacgtcatacagagcgatggtctgctgatc
aaaaatccgacggaagcggacgatggcagctacacgtgccgggcttatgccgtctcgacc
ggcggcttcaaagagagagtgattaagctggaagtgattattcccccggtgatcaaagac
atggagcctgtttcggtgatcgagggcgaacaagcctggaccaagtgcgaagccacggga
aaaccgccaccaacttacagctggatcaagcaacggaacagccaagacttgtcgaagagt
gaccgcttcaccgtcaaacagaccaccgggaatctcctcatcagcaaagtggaattcaac
gacgacgatttttacaaatgcacggcggagaacaaggccggacgtgccgaaaaaaccgtc
aaaatcaacgtcttggtcaagccgaaaattttcgaattgctcaacgtcacggcacccgtg
caccaggaaacgaagattatctgcaaggcaaggggacggcccacacctaaagtttacttc
cggaaagtgagcgataaggagcacccgttccgggtgggccaacagcgcgacccccggatt
attctggaggagcagatgttcgagaaaacgggggagacgtttggcacgcttatcataagc
aacttgaacaggtcggacgacgggctgtacgagtgcattgccgagaacagcgctgggacc
ggctacaaaaacggtcacattactgttgaatttccgccgacttttgagcgcaccaagctc
ctggagcccatcgcctggacgtggctcaaccaccccgggaacctcacgtgcatcccggaa
gccatcccgaacgccacagtggtgtggaagcacaacggctacatcataaacccggggaac
cccccgtttaaaatccagggtttcgggcccacctctcacctgattgttgacgcgttcaac
gacccgcgtttttacggcgagtacgagtgtctggcgaccaacaagctggggaaggcgacg
cactcgatcacgctaaaggaggcccaagtgcccgcaaatgtggacaaggtgcagattcaa
accctcacggccactactatcaaattcaacattgttccacctcagtactttgatacgctc
ccgattcggtcgtttacggttcagtataagcctgaaggggagattgggtggtcgcgtgcc
aggaacaggacgtggagttttagggcaccgtatattttggagaatttggtgccggaagtg
acttataattttcgatttgcggcggctaatgatgtgggatttgggccgtggacgaatgcg
cccacggtgacgatgccaaggcggtcggaaccggccgagccgaagatttatgtacctaat
catattttggataatagtagtaataggcaggatgtggttgctgtgagtccctatgcggac
catttcgagttgaggtggcaagtgccgaatgataacggcgatccgattgatgtttatctc
ataagatattgtgtgataacgaaaatcaacggcgagtggcgcgacagcgactgcagcgaa
gagatccagcaaacgttcaaatcgaccacttatgatttaaactcgttgaaacccgatacg
ttctacaaaatcgaactgcgtgctcacaactcaatcggttcaagttcaccggctcaaatc
aaagtgaaaacagccagaggcatcgaccctgcagtgccctacaacgagccttcagtcact
aatttcgcaataattggaatcgtggtgggagcagtcattcttgtgctaattctcgtcgac
ttaatctgtttttgcgtgaaccgcgcgggaattctcgcgtttatctgcgatcgaaaccga
tcgaagcaccatgaagaggacccgaaactaggaagtctatacagttggcgatttccgctg
ccttattgcagttacaaagctgccccggcgcatcccaacagtctcaacttgcccctacct
gtcaaactggcaccatcaccaatggaggaagagcgtgagcctctaaaggacgcccacatg
aacggaggagagaaaaccatgtccgtggaattcgacggcaagcacgtctactcaaaatcg
ggcgaaataatcggcaaacattcggccgtttaa

DBGET integrated database retrieval system