KEGG   Thermobacillus composti: Theco_1624Help
Entry
Theco_1624        CDS       T02394                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
tco  Thermobacillus composti
Pathway
tco00520  Amino sugar and nucleotide sugar metabolism
tco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Theco_1624
Enzymes [BR:tco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Theco_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGA57761
UniProt: L0EDJ2
Position
1708984..1710171
Genome map
AA seq 395 aa AA seqDB search
MKGLWIRNANVYLPDRVLTGGSVYAAGGRIARICGPEDGSPAKPDDADEVWDAEGLSIVP
GFVDVHVHGGGGADVMDAADDDEAIGRIARFHALHGTTSFLATTMTAPRNELERAVVGVV
RAMERGVAAGGAEVLGLHLEGPFLNPRRCGAQNPALIRPFDRDEMEDLLARGRGAVRLVT
LAPECGDALRRIGALRDRGVTVSIGHSEADSETVRRAIEAGASHVTHLFNAMNPLHHREP
GIVGAALLRDELTVELICDGFHVHPDVVKLVFAVKRRDKIALVTDAIAAAGMPDGDGYRL
GGLPVAVKEGKAVLRDSGNLAGSCLTMDRALKQAVAFTGLPLAEVLPALTINPARQIGAD
DCKGSIEVGKDADLVALGPDLTVVRTYVKGVRVDG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggattgtggatcaggaacgccaatgtctatttgcccgatcgggtgttgacgggc
ggttcggtgtatgcggccggcgggcggatcgcgcgcatatgcggtccggaggacggttca
ccggcgaagccggacgacgccgatgaagtgtgggacgccgaaggactctcgatcgtaccc
ggattcgtcgacgtccacgtgcacggcggcggcggggccgacgtgatggacgcggcggac
gatgacgaggccatcgggcggatcgcgcggtttcacgcgttgcacgggacgacgtctttc
ctggccaccacgatgacagcgcccagaaacgagctcgaacgtgcggtggtcggcgttgta
cgcgcgatggagaggggcgtcgccgccggcggtgcggaggtgctcggccttcatctggaa
gggccgttcctcaacccccggcggtgcggcgcgcaaaacccggcgctcatccgtccgttt
gaccgggatgaaatggaggatttgctggcgcgcgggcggggagcggtgcgcctggtgacg
ctggcgccggagtgcggcgacgcgctgcgccggatcggcgctctgcgcgaccgcggcgtc
acggtctccatcggccattccgaagccgactcggagaccgtgcggcgggcgatcgaggcg
ggggcgtcgcacgtcacccacctgttcaacgccatgaacccgctgcaccatcgcgagccg
ggcatcgtcggcgccgcgctgctccgcgacgaactgacggtggagctgatctgcgacggg
tttcatgtccatccggatgtggtcaagcttgtgttcgcggtcaaacgccgcgataagatc
gcgctggtgacggacgcgatcgcggcggccggcatgccggacggcgacggctaccggttg
ggcgggctgcccgtggcggtgaaagagggcaaggcggtgctccgggacagcggaaatttg
gccggcagctgcctgacgatggaccgggcgctgaagcaggcggtcgcgttcaccggcctg
ccgctggccgaagtgcttcccgcgctgacaatcaatcccgccaggcaaatcggcgcggac
gactgcaaaggatcgatcgaagtcggcaaagacgccgatctggtggcgcttggaccggat
ttgacggtggtccgcacgtatgtcaaaggagtgcgtgttgatggctga

DBGET integrated database retrieval system