KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1893
Entry
Tgr7_1893         CDS       T00840                                 
Name
(GenBank) TRAG family protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tgr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Tgr7_1893
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tgr02044]
    Tgr7_1893
Enzymes [BR:tgr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Tgr7_1893
Secretion system [BR:tgr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Tgr7_1893
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Other DBs
NCBI-ProteinID: ACL72974
UniProt: B8GSS0
Position
2018806..2020818
AA seq 670 aa
MQGTNVLFGQIAVVFGIVIAGVWGATQWTAAALGYQVRLGSPWFDILGTPIYYPWKLFEW
WFSYGAYTPEIFDTGGAIAGSSGMVAVTVAIAMSVWRSRQARLVTTYGSARWANAQDIRK
AGLTQPAGVFLGQHDRQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKG
ENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
KRNHWEKTSHALLVGAILHVLYAGQDKTLRGVANFLSDPASPFELTLHRMMTTPHLVNEE
GGGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIAAE
HPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIKRRHKLLLMLDEFPALGR
LDFFETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRIS
ETLGTATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVA
PIRAKKLRYYADANFKRRVLSPPVLADSQYADAPPLRPDDWSGLAIPPTPTAPATAPADG
LGSADDGGPRRQPELSEVVAYDPELAAPAADLGLLDDDDDLPLPLPRQLDPAMQRAARLA
SLNPNDGIEL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgcaagggacaaacgtgctgttcggtcagatcgccgtggtgttcggcatcgtgatcgcc
ggcgtgtggggcgccacacagtggacagcagcagcccttggttatcaagtacgccttggc
tcgccctggttcgatattcttggcacgccgatctattacccgtggaagctgtttgagtgg
tggttctcttacggcgcctataccccggaaatcttcgacacgggcggtgccatcgccggc
agcagtggcatggtcgcagtgaccgtcgccattgctatgtcggtctggcgctcgcggcag
gcacgccttgtcacgacctacggatcggcccgctgggcaaacgcgcaggacattcgcaag
gcgggtctcacgcagccggcgggcgtgttcctcggccagcacgaccgccagtacctgcgc
catgaagggccagagcatgtcctgacgttcgcacccacgcgcagcggcaagggcgtcggc
ctcgtggtgccgacgctgctttcctggcccgcgtccgccgtcatccacgacatcaagggc
gagaactggcagatcaccgcaggctggcgctcgcgtttctcgcactgcctgctgttcaac
cccacggatgcgaagtcggcggcctacaacccgctgctggaggtacggcgcggcgcgcat
gaagtgcgcgacgtgcagaacatcgcggacatcctggtcgatcccgaaggcgcgctggag
aaacgcaaccattgggaaaaaacttcgcacgcgctgctggtcggcgccatcttgcacgtc
ctttacgccgggcaggacaagacgctgcgcggcgtcgccaacttcctctccgacccggcc
agcccattcgagctgaccttgcaccggatgatgaccacgccgcacctcgtgaacgaggaa
ggtggtggcccgcatcccgttgtggcgtccgctgcgcgcgaagtgctcaacaagtcggac
aacgagcgttctggcgtgttgagcaccgccatgtcgttcctcggcctttatcgcgatccc
actgtggccgaagtcacctcgcgctgcgactggcgcattgccgacctgatcgccgccgag
catccggtatcgctgtacctggtggtgccgccttcggacattagccgcacgaagccgctg
atccgcctgatcctcaaccagatcggacggcggctcaccgaatcgctggacggctccgac
ggcatcaagcgccgccacaagctgctgctgatgctcgatgagtttccggcactcgggcgc
ttggattttttcgagaccgcgttggccttcatggcgggctacggcatccgcagcttcctc
atcgcgcagtcgctcaaccagatcgacaaagcctacggccaaaaccattcgattctggac
aactgccatgtgcgtgtgacgttcgccaccaacgatgaacgcaccgccaagcgcatttcc
gagacgttgggcaccgcgaccgagttgcgcgcacagcgcaactacgcgggccaccggctc
gcgccgtggctgggccacctcatggtgtcgcgccaggagacggcccgcccgctgctgacg
cccggcgaagtcatgcagcttccgcccgacgaggccgtggtgatggtctccagcgtggcg
ccgatccgggcaaagaagctgcgctactacgcggacgccaatttcaagcggcgcgtgctg
tcgccgcccgtgttggcggacagccaatacgccgacgcgccgccgctgcgccccgacgac
tggagcgggctggcaatcccaccaacgcccaccgcaccggccacggcacccgccgatggc
ctcggttccgccgacgacggcggcccgcgccgtcagcccgagctttccgaagtcgtcgcc
tacgaccccgagttggccgcgcccgcagctgacctcgggctgctcgatgacgacgacgac
ctgccgcttccccttcctcgccagctcgatccggccatgcagcgcgcggcccggctggca
tcgctgaaccccaacgacggaatcgagctatga

DBGET integrated database retrieval system