KEGG   Taeniopygia guttata (zebra finch): 100217747
Entry
100217747         CDS       T01082                                 

Symbol
ABCC10
Name
(RefSeq) multidrug resistance-associated protein 7
  KO
K05674  ATP-binding cassette, subfamily C (CFTR/MRP), member 10
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100217747 (ABCC10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tgu02000]
    100217747 (ABCC10)
Transporters [BR:tgu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    100217747 (ABCC10)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N DUF87 MMR_HSR1 AAA_29 AAA_21 AAA_16 MeaB Sulf_transp AAA_23 DUF4703 Dynamin_N
Other DBs
NCBI-GeneID: 100217747
NCBI-ProteinID: XP_012427905
Ensembl: ENSTGUG00000009082
UniProt: H0ZFL1
Position
3:78601796..78624314
AA seq 1539 aa
MENILASLCGTSPEDPLPVWVRGSIGHCFNQLTLSVIPHVILAVVSAGFLGTPRSGSGVP
CRPSWGWRIAISFLLAGLFLADTIPATISQQELGPVYLEVLANGTAAVTWLVHGFALFML
CRSIHGFTRGPAALALLTLSPLPSFIITLVWYCQSGTAWSPAHPGASTRFAILCLQLVSL
LAYVVSYLFPTAGRQDSLSINYSWQQDQPISEPEIPVPDLQRVAEDGESWLSRLFYIWMN
PLMKRGYQQKLNQPQDVYVLPHQLQAARVCDWFYFCWQKKAALQQADEETVSLTSPIIAG
GDGSSDAPDSPHHAQEAVCFLSVLHAAFGLRFYTLGLLKLAGNLLDFSGPLLLNLLVNFM
ESRQEPLSHGILYALGLFAGSFLGALLRSQFRYEMNKMALMVRAAVISTIYRKALRVSSA
SLARFTVGEIVNFMSTDTNRLINFCHSFHELWSLPVQFAITLYLLYQQVGVAFLGGVALA
LLLVPINKIIANRIMENNKKMLKHKDTRVKLMTEFLCGIRVIKFYTWEKHFSTRIKSCRA
KELQKLRAVRYLDALCVYMWAALPVVVSITIFVTYVLLGHQLTATKVFTALALVGMLILP
LNGFPWVLNAILEAKVSLDRIQQFFELVDQDLEAYYALASPSDTATAMEMQCATFSWVPV
EEESTRQPSSTGTLQLHIENLSVRKGMFLGVVGKVGSGKSSLLAAITGELIKQGGRVYVC
DLEQGFGVATQEPWIQFTTVRKNILFGREYDARLYKEVLEACALSEDLNILPASDQTEVG
ENGVTLSGGQKARIALARAIYQEKELYLLDDPLAAVDADVANHIMRKCIFGVLKHKTRVL
CTHRTEFLEKADALLLMDNGRIVKTGTPADILPLVEAFPKFKDTDKGHKDKAPIEQGQEE
AVKTEAEEPTQNNNLIHKEEEKKEGAVAFQVYKAYWMAMGSCLAISILFSLFLMQASRNI
SDWWLSYWMSSISQTANTSEMACSASLPSPELLLFSTAGLVSPIQGLDKTPAPPNGSVDV
NFYLIVYGSIAGANSLFTIIRAFLFAYGALRAAAVIHDRLLQRVLKATVTFFDTTPTGRI
LNRFSSDLYCVDDSLPFILNIFLANIYGLLGMLVIMTYGLPWIGLVLLPLAVVYFFIQRY
YRFTSRELKRLCSVTLSPIYTHFSETLSGLSTIRAMQATKRFELENQLRLEQNQRCLFAS
NTVMEWLDIRLQMIGVAVVTAIAGIAIIQHQKQLGNPGLVGLALSYALSVTNLLSGLIAS
FTHTEMLMVSVERTEEYTTDIPMEPQDKLVQVSADWPSEGLVEFQQVVLAYRAGLPNALD
GVSFTVYPGEKLGIVGRTGSGKSTLFLALFRMVEMKSGQILLDGVDSQLVGLEELRSRLA
IIPQDPFLFSGSIRENLDPQGKRADAELREVLEQCHLWDVVTQMGGLDSELGERGKSLSV
GQRQLVCLARALLTQAKVLCIDEATASVDQKTDQLLQQTIHQRFADKTVLTIAHRLNTIL
DSDRVLVMQAGRVAELDSPARLSQKDGSLFQHLLHRRQQ
NT seq 4620 nt   +upstreamnt  +downstreamnt
atggagaacattctggctagtttgtgtgggaccagcccagaagatccactccctgtgtgg
gttcgtggcagcattggccattgctttaaccagctgacactaagtgtgattcctcatgtg
atccttgcagtggtcagtgccggcttccttggcactccaaggtctggctctggtgtgcct
tgcaggccaagctggggatggagaatcgctatctccttcttacttgctggcttgttcctt
gctgacaccatcccagccaccatttcccagcaggagctgggccctgtgtacctggaagtg
ctggccaatggcactgctgctgtgacatggctggtgcatggcttcgctcttttcatgctc
tgcaggtccattcacggatttaccaggggccctgcagccctggctctcctcaccctctca
cctctaccttccttcatcatcacgctggtgtggtactgccagagtgggacagcttggtcc
cctgcccaccctggtgcctccaccaggttcgccattctctgtctgcagctggtctctctg
cttgcctatgtggtcagctacctcttccccactgctggcaggcaagactccctctccatc
aattactcctggcaacaagaccagcccatctcagagccagagatcccagtgcctgacctg
cagagagtggcagaagatggtgagagctggctctcacgcttattttacatctggatgaac
ccccttatgaagcgtggctaccagcagaagctgaaccagccacaggacgtctatgtgctt
cctcaccagctccaggctgctagggtctgtgactggttctacttttgctggcagaagaag
gcagctcttcagcaagcagatgaggagacagtctctcttaccagcccaataattgctgga
ggtgatgggagtagtgatgctccagacagcccacaccacgcccaggaagctgtgtgcttc
ttgtcagtccttcatgcggcctttgggcttcgtttctacacccttggacttctcaagctg
gctggcaatctgctggatttttcaggtcctctgcttctgaacttgctagtgaacttcatg
gagtcgcgtcaggagcccctgagccatgggattctgtatgcccttgggctctttgctggc
tccttcctgggcgctctcttgcggagccagttcaggtacgagatgaacaagatggcgctg
atggtgagggctgccgtcatctccaccatctaccgcaaggctctgcgtgtcagcagcgcc
agccttgcccgcttcaccgtgggggaaattgtcaacttcatgagcacagacaccaatagg
ttgatcaacttctgccacagcttccacgagttgtggagcctgcctgtccagtttgccatt
accctctatctcctctaccagcaagtcggggtagcctttctgggaggcgtggccctggca
ctgctgctcgtgcccatcaacaagatcatagctaaccgcatcatggagaacaacaagaag
atgctgaaacacaaggacacgcgagtcaagctaatgacagagttcctgtgtggcattcgt
gtgatcaagttttacacctgggagaagcacttcagcaccaggataaaatcctgccgggct
aaagagctgcagaagttacgggccgtcagatatctggatgctttgtgcgtgtacatgtgg
gcagcactccctgttgttgtctccattaccatctttgtcacctatgtcctgttgggtcac
cagctcactgccacaaaggtgttcacagcattggcccttgttgggatgcttattctaccc
ctcaatggattcccatgggtgttgaatgcgatcttggaggccaaagtttccctggatcga
atccagcaattctttgaactcgtagaccaggacctggaagcttattatgccctagctagc
ccttcagatactgctactgccatggagatgcaatgtgcaaccttctcatgggtgccagta
gaggaggaaagcaccaggcagccctcatccacaggcactctgcaactacatatcgagaac
ctgtcagtgagaaagggaatgttcctgggggttgttgggaaggttggctctggcaaaagc
tctctgcttgcagccatcactggagagctcattaaacaaggtggacgagtgtatgtttgt
gacctggagcaaggatttggtgtggccacacaggagccttggatacagtttaccactgtc
cgcaaaaacatcctttttgggcgggaatatgatgccagactgtacaaggaggtgctggag
gcctgtgccctctccgaggacctaaatattttacctgcaagtgaccagacagaggtgggt
gaaaatggtgtgacactcagtgggggacagaaggctcgaatagcccttgccagagcaatt
taccaggagaaagaactttacctccttgatgatcccctggctgctgttgatgcagatgta
gccaaccatattatgaggaaatgcattttcggagttctcaaacataagaccagggtcctt
tgcactcacaggacagagtttttggagaaggccgatgccttgttgctgatggacaatggc
aggatagttaagacaggcacaccagctgatatcctgccacttgttgaagccttccccaag
ttcaaggatacagacaaggggcataaggataaagcccctattgaacagggacaggaagag
gccgtaaagacagaggcagaagaaccaacccaaaacaataatctcatccacaaggaggaa
gagaagaaagaaggggcagtggcttttcaggtgtacaaggcctattggatggcaatgggc
agctgcttggcaatatcaatcctcttctcactgttcctgatgcaagcatccagaaatatc
tcagattggtggttgtcatactggatgtccagcatatcccagacagcaaatacctctgag
atggcctgctcagcttccctgccttctccagagctgcttctcttctccactgctgggctt
gtctcccccattcaaggtctggacaagaccccagcccctcccaatggctcagtggatgtg
aatttctacctgatagtttatgggagcattgcaggggccaattccctcttcaccattatt
cgggcattcctctttgcttatggtgctctccgtgctgccgctgtcattcacgaccgactg
ctccaaagggttctaaaggccacagtcaccttctttgacaccacaccaacaggccggata
ctgaaccgcttctcctcagacctatactgtgtggatgacagcctgccatttatcctcaac
atcttcctagccaacatctatgggctcttgggcatgctggtgataatgacctatggcctc
ccttggattggtctggtcttgctccctctggccgtagtctacttcttcattcagcgctat
taccgattcacatcccgggagctcaagcgcctctgcagtgtcaccctgtctcccatttac
acccacttctcagagaccctctcaggactgagcactatcagagccatgcaggcaacaaag
aggtttgagctggagaatcagctgcgtctggagcagaaccagcgctgtctctttgccagc
aacacagtgatggagtggctggacatccgcctgcagatgattggggttgctgtggttact
gctattgcagggattgccatcatccagcaccagaagcagctgggaaatccaggacttgtg
ggcctggcactctcatatgccctgtctgtcacaaacctgctctcaggcctcatagccagt
ttcactcacacagagatgctgatggtgagtgtggagaggacagaggagtataccacagac
atccccatggagccccaggataaactggttcaggtttctgctgactggccaagtgagggg
cttgtggagttccagcaagtggtcctggcatacagagcaggcttgcctaatgcacttgat
ggcgtgagcttcactgtttaccctggagagaagctggggattgtgggtcgcacaggatct
gggaaatccacccttttcttggcccttttccgtatggtggagatgaaatcaggccagatt
ctcctcgatggtgttgacagccagctggtgggcttggaggagctgagatctaggctggcc
atcatcccgcaggatccatttttgttcagtggctcaatcagagaaaacctggacccccag
ggaaaacgggcagatgctgagctccgcgaggtgctggagcagtgccacctgtgggatgtt
gttactcagatgggtggactggacagtgagctgggagagagaggaaagagtctgtctgtg
ggacagaggcagctggtgtgtctggccagagccctcctgacacaggccaaggtgctgtgc
atcgatgaggccacagccagtgtggatcagaagacagaccagctgctgcagcagaccatc
caccagcgcttcgctgacaaaactgttttgacaattgctcacaggctaaacaccatcctg
gactcggaccgcgtgctggtgatgcaagctgggagagtggcagagctggattcacctgcc
cgcctaagccagaaagatggctccttgttccagcacctcctgcacagaaggcagcagtga

DBGET integrated database retrieval system