KEGG   Taeniopygia guttata (zebra finch): 100221984
Entry
100221984         CDS       T01082                                 
Symbol
ABCG2
Name
(RefSeq) broad substrate specificity ATP-binding cassette transporter ABCG2 isoform X1
  KO
K05681  ATP-binding cassette, subfamily G (WHITE), member 2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100221984 (ABCG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tgu02000]
    100221984 (ABCG2)
   04147 Exosome [BR:tgu04147]
    100221984 (ABCG2)
   04090 CD molecules [BR:tgu04090]
    100221984 (ABCG2)
Transporters [BR:tgu02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    100221984 (ABCG2)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100221984 (ABCG2)
CD molecules [BR:tgu04090]
 Proteins
  100221984 (ABCG2)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 SMC_N AAA_23 RsgA_GTPase AAA_29 PDR_assoc DUF87
Other DBs
NCBI-GeneID: 100221984
NCBI-ProteinID: XP_030127803
Ensembl: ENSTGUG00000002200
Position
4:complement(61163238..61182661)
AA seq 663 aa
MVEDQPHLCIQMSEPSTNGIPSRMQPLPDLSGRVGSVLTFHNIYYHVKIKTGFLCFQKTT
KKEVLRDVNGIMKPGLNAILGPTGSGKSSLLDILAARKDPRGLSGDILINGAPQPANFKC
TSGYVVQDDVVMGTLTVRENLQFSAALRLPKSVKEQEKNERVNQIIKELGLSKVADSKVG
TQFSRGVSGGERKRTNIGMELITDPAILFLDEPTTGLDASTANAVLLLLKRMSKQGRTII
FSIHQPRYSIFRLFDSLTLLAAGRLLYHGPAQHAIEYFQSIGYQCEPYNNPADFFLDVIN
GDSTAVAMNKADESNTADSTEERSEYDKALAEQLAEKYCNSAYYQETKVHLESISSGNKK
KTKGLFRQITYANSFLHQLKWVSRRTFKNLIGNPQASIAQLCITSFLGLVVGAIYFGLEE
NSAGLQNRVGAMFFLTTNQCFSSVSALELFVVEKKIFIHEYISGYYRTSVFFIAKLMADL
IPIRTMPSIIFTCIVYFMLGLKPTVQAFFTMMFTLMMVSYTATSMALAIAAGQSVVAIAN
LFMTVAFVFMIIFSGLLVNLTSIMSWLSWLKYFSIPRYGMTALQINELTDLNFCGSSNTT
VLSSDSSYRQTDQMPCTGEEYLKSQGIDASTWGLWQNHLALACMTLIFLTIAYLKLHFMK
KFS
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggtagaagaccagccacacctatgcattcagatgtcagaacccagtacaaatggcatt
cccagtagaatgcagcccttgccagacttgtctggcagggtaggaagcgtgctcaccttc
cacaacatctactaccatgtgaagataaagactgggttcctgtgtttccaaaaaaccacc
aaaaaagaagttttgagagatgtcaatggcattatgaaaccaggactgaatgccattttg
ggacccactggcagtggtaaatcttcgctactggacattttggctgcaaggaaggatccc
cgcgggctctctggtgacattttgatcaatggagctcctcagcctgccaactttaaatgt
acctctgggtatgtagtacaggatgatgtggtcatgggaaccctgactgtaagagaaaat
ctgcagttctcagcagcactccgcttgccaaagtcagtgaaggaacaggaaaaaaatgaa
cgagtgaatcagataatcaaggaactgggtttgagcaaagtggcagattccaaggttggt
acccagttctcccgtggggtgtctggaggagagcggaaaaggaccaatattgggatggag
ctcataacggatcctgccatcttgtttttggatgaaccaaccacgggacttgatgctagc
actgctaatgctgtcctactgctactgaaaaggatgtcaaaacaaggaaggacaatcatt
ttctccatccaccagcctcggtattccatattccgactgtttgacagcctgacactgcta
gctgcagggagactgctgtaccatgggccggcccagcatgccatcgaatactttcaatcc
attggctaccagtgcgagccctacaacaaccctgccgattttttcctggacgtcatcaat
ggagactccaccgccgtggcaatgaacaaggcagatgaaagtaacacagcagacagtact
gaagaacgctctgaatatgataaggcattggctgagcaattagcagaaaaatactgcaac
tctgcctactaccaagaaacaaaagtacatttagagagcatttcttcaggaaataaaaag
aaaaccaaaggacttttccggcaaatcacatatgccaattccttcctccaccagctgaaa
tgggtgtccaggcgcacgtttaaaaacctgataggaaaccctcaggcttccatagctcag
ctttgtattacatcttttctgggactggttgtaggcgccatctactttggacttgaagag
aactctgctggactacagaacagagtgggtgcaatgttctttctgaccaccaaccagtgt
ttcagcagtgtctcagctcttgaactctttgttgtggaaaagaagatatttatacatgaa
tacatcagtgggtactacagaacatctgtattcttcatagcaaagctgatggctgattta
atacccataaggactatgcccagcatcatcttcacctgcatagtttacttcatgctaggt
ttgaaaccaacagtacaagccttctttaccatgatgttcactcttatgatggtgtcctac
acagccacttccatggcacttgccattgcagcaggacagagcgtggtcgctatagcaaac
ctattcatgactgttgcatttgtttttatgattattttctctgggttgctggtcaatctt
acaagcatcatgtcctggctctcctggctcaaatactttagcatccctcgatatggaatg
acagctttacagatcaatgagttgactgatctgaacttctgtggcagcagtaatacaaca
gttttaagcagtgacagtagctatcgacagacagaccagatgccatgtacaggagaggag
tatctgaagagtcaaggcatcgatgcaagcacctggggcctgtggcagaaccacctggct
ctggcctgcatgacactgatcttccttaccattgcctacctcaaactgcacttcatgaag
aagttctcttaa

DBGET integrated database retrieval system