KEGG   Taeniopygia guttata (zebra finch): 100223904
Entry
100223904         CDS       T01082                                 
Symbol
MAPK8IP1
Name
(RefSeq) C-Jun-amino-terminal kinase-interacting protein 1 isoform X1
  KO
K04434  mitogen-activated protein kinase 8 interacting protein 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100223904 (MAPK8IP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100223904 (MAPK8IP1)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100223904 (MAPK8IP1)
SSDB
Motif
Pfam: PID SH3_9 SH3_1 PID_2
Other DBs
NCBI-GeneID: 100223904
NCBI-ProteinID: XP_002200184
Ensembl: ENSTGUG00000010712
UniProt: H0ZKC5
Position
5:complement(24034664..24059691)
AA seq 699 aa
MAEREKGAASPPASPFLGLHLASPPNFRLTHDISLEEFEDEDLSEITDECGISLHCKESL
ATRGHVSRAGGAARAAGGGEASRLQAEMLQLDLIDAAGDTPAEEQTAPEPLQKDPPAGTT
EVYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQERVSRSSSPLKTGEQTPPHDHVCL
SDEVNHQNSTTSTKDRGTSTESPCRRTAATQMAPACVASSRPPEKHQATSQAPPHGASIV
VVTRGPEAHRDRIRYQTDVRLEATEEIYLTPVQKNSDPLETDKPFLSQSSENRMSISSDI
DTSGYSALAGKTNPSISEEDEVLDYMSSPDKTNLPRASCGGGSGGSRPGHNLQRASVSSD
TSALSYDSVKYTLVVDENVQLELVSLKQCYSGYSDESDSATVYDNCISSPYESAIGEEYE
EDALKRDSVCLSEDSTPEADIHFSKKFLNVFMSGRARSSSAESFGLFSCMINGEEQEQTH
RAVFRFVPRHADELELEVDDPLLVEVQAEDYWYEAYNMRTGDRGIFPAYYAIEVTKDPDH
VTALAKSSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEI
SVRGVKIAVKADDSKEHSKVNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACH
VFVSEESTKPLAESVGRAFQQFYKEYVEYTCPTEDIYLE
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggcggagcgagagaaaggagctgcatccccgcccgcctcacccttcctggggctgcac
ctcgcctcgccccccaatttcaggctcacccatgacatcagccttgaggaatttgaggat
gaagacctctctgagatcactgatgagtgtggaatcagcctgcactgcaaggagagcctg
gccacccggggccatgtgagccgggcgggcggcgcggcccgggcggcgggcggcggggag
gccagccggctgcaggccgagatgctccagctcgacctcatcgacgcggcgggggacacg
ccggccgaggagcagacggcgcccgagccgctgcagaaagaccccccggccgggaccacc
gaagtctacaggccgaagcgacccacaaccctcaacctcttcccgcaggtgcctcgcagc
caggacactctgaataacaactctctggggaaaaagcacagttggcaggagcgggtgtcc
cggtcgtcgtcccctcttaaaacgggtgagcagacccctccccatgaccacgtttgcctg
agtgatgaggtcaatcaccaaaacagcacaacctccaccaaagaccggggcacatccacg
gagagcccatgccggcgcacggcagccacacagatggccccagcctgcgttgcctcgtcc
cggccacccgagaagcaccaggccaccagccaggccccaccacatggtgccagcatcgtg
gtggtaacgaggggccccgaggcccaccgggaccgcatccgctaccagacggatgtgagg
ctggaggccacagaggagatctacctgacgcccgtgcagaagaactcggaccccctggag
actgacaagccgttcctgtctcagtccagtgagaaccgcatgtccatcagctctgacatt
gacacctccggctattcggccctggcagggaaaaccaacccctccatcagcgaggaggac
gaggtgctggattacatgtcctcccctgacaagacaaacctgcccagggcctcctgtggt
ggcgggagtggtggctcccggccagggcacaaccttcagagagcctctgtgagttcggac
accagtgccctctcctatgactctgtcaaatacacgctggtggtagatgagaacgtgcag
ctggagctggtcagcctcaagcagtgctactcaggctacagtgatgagagcgactcggcc
acagtctacgacaattgcatctcttcaccctatgagtcggccattggcgaggagtatgag
gaggatgcgctgaagcgtgactcagtctgcctctctgaggactccacccccgaggcagac
atccacttctccaagaagttcctcaatgtcttcatgagtggtcgagcacgctcctccagt
gccgagtcctttgggttgttctcctgcatgattaacggggaggagcaggagcagactcac
cgtgctgtctttaggtttgtgcctcgccacgcggatgagctggagctggaggtggatgat
cctttgctggtggaggtgcaggcagaagattattggtatgaggcctacaacatgcgcaca
ggagatcggggcatcttccctgcctactatgctattgaagtcaccaaggacccagaccat
gtaacagctctggccaagagcagtgactgggtggaccagtttcgggtgaagttccttggc
tctgtgcaggttccctaccacaagggcaatgacgtgctctgtgcggccatgcagaagatt
gccaccacacgccgcctcactgtgcactttaacccaccctccagctgcgtcctggagatc
agtgtgcgcggggtcaagattgctgtgaaagctgacgactccaaggaacacagcaaggta
aacaagtgtagccattttttccagctgaagaacatttctttttgtgggtaccatccaaag
aacaacaaatattttgggtttatcaccaagcaccctgctgaccacagatttgcctgtcat
gtcttcgtctcagaggagtccacgaagccactggcggagtctgtagggagggcttttcag
caattctacaaggagtatgtggagtatacgtgccccacagaggacatctacctggagtag

DBGET integrated database retrieval system