KEGG   Taeniopygia guttata (zebra finch): 100224317
Entry
100224317         CDS       T01082                                 

Gene name
ACADL
Definition
(RefSeq) long-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00255  long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00071  Fatty acid degradation
tgu01100  Metabolic pathways
tgu01212  Fatty acid metabolism
tgu03320  PPAR signaling pathway
Module
tgu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100224317 (ACADL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100224317 (ACADL)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.8  long-chain acyl-CoA dehydrogenase
     100224317 (ACADL)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Other DBs
NCBI-GeneID: 100224317
NCBI-ProteinID: XP_002197059
Ensembl: ENSTGUG00000011392
UniProt: H0ZMD6
Position
7
AA seq 431 aa
MAARLLRLRSLLRAAGSRPFSAQPSPLQTEQHGTKRLEPSSAKTLIDIGTRRIFSSEHDI
FRESARKFFQEEVLPFHAEWEKEGQVSRELWEKAGQQGLLGVAIAEKHGGIGADILSSAI
VWEEQMYVNCTGPGFSLHSDIVMPYIANYGSEEQIKHFIPQMVAGKCIGAIAMTEPGAGS
DLQGVRTYAKKDGSDWILNGSKVFITNGWMSDVVIVVAVTNREARSPAHGISLFLVENGT
KGFIKGRKLQKIGLKAQDTAELFFEDVRLPASALLGKENKGFYYLMAELPQERLLIADMA
LASCEFMFEETRNYVRQRKAFGKTIAHLQTVQHKLAEIKTQICVGRAFMDNCLQLHADKR
LDSATASMAKYWCSDLQNSVATQCVQMHGGWGYMWEYPIAKAFVDARVQPIYGGTNEIMK
ELIARDIVSDK
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggcggcgcggctgctccgcctgcgcagcctgctgcgggccgccggctcccggcccttc
tccgcccagcccagtcccctgcaaacagaacagcatggcacaaagcgcctggaaccatct
tctgctaaaactttgattgacataggcactcggaggatcttctcatcagagcatgatatc
ttcagggagagtgccaggaaattctttcaggaagaagtgctgccttttcatgcagagtgg
gagaaggagggccaagtgagcagggagctctgggaaaaagctgggcagcagggcttgctg
ggtgttgctattgctgagaaacatggaggcatcggagcagatattctctcttcagccatc
gtctgggaggagcagatgtatgttaactgtacaggcccagggttcagccttcattcagat
atagtcatgccctacattgcaaactatggctctgaagaacagattaagcactttatcccc
cagatggttgcaggcaagtgcattggagctattgccatgacagaacctggggctggcagt
gacttgcagggagtacggacatatgcaaaaaaagatggaagtgactggattcttaatggg
agtaaggtgttcatcactaatggttggatgagcgacgtagtgatcgtggttgcagtcaca
aaccgggaggcgcgatcccctgctcatgggatcagcctttttctggtggaaaatggaaca
aaaggtttcatcaaaggacgcaaacttcaaaaaattggcctgaaagctcaagacacagca
gagctgttttttgaagatgtgcggctgccagccagtgccttgcttggaaaggagaacaaa
ggcttctactatctgatggcagagctgcctcaggaaaggctgctaattgctgatatggct
cttgctagctgtgaattcatgtttgaagaaacaaggaattatgtgaggcaaagaaaagct
tttgggaagacaattgcacatttgcagacagtacagcacaagttggccgaaataaaaact
cagatttgtgtgggccgagcttttatggacaactgtttgcagctgcatgcagataaacgc
ctggactctgccacagcctccatggccaagtactggtgttctgatctccaaaacagcgta
gctacccagtgtgtacaaatgcacggaggatgggggtacatgtgggagtatccaattgca
aaagcttttgtggatgcccgtgttcagccaatctatggtggtaccaatgaaataatgaaa
gaacttattgctagagacattgtcagtgacaagtag

DBGET integrated database retrieval system