KEGG   Taeniopygia guttata (zebra finch): 100226046
Entry
100226046         CDS       T01082                                 
Symbol
EPS15
Name
(RefSeq) epidermal growth factor receptor substrate 15 isoform X7
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100226046 (EPS15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tgu04131]
    100226046 (EPS15)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100226046 (EPS15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 Crescentin TMF_DNA_bd AAA_13 ESSS UIM DUF3584 HAP1_N Fib_alpha
Other DBs
NCBI-GeneID: 100226046
NCBI-ProteinID: XP_002197029
Ensembl: ENSTGUG00000008685
Position
8:5993028..6061558
AA seq 915 aa
MAARLSLAQLSSANPVYEKFYRQVDSANAGRVLASDAAVFLKKSGLTDLVLGKIWDLADT
DGKGILNKQEFFVALRLVACAQNGLDVSLSSLNLPVPPPRFTDTSSPLLLSGTASSDLPW
AVKLEDKVKYDSIFDSLNPVNGLLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDR
DEFAVAMFLVYCALEKEPVPMSLPAALVPPSKRKPLSVPGAMPLIPSSTKESHQSLPPVG
ILAAKTPLTQWVVSPADKIKYDEIFVKTDKDMDGFVSGVEARELFLKTGLPSTLLAHIWA
LCDTKDCGKLSKEQFALAFHLINQKLTKGIDPPQALTPEMIPPSDRGVSLQKSTQGPNSV
ADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDAIKQRTSEVQDLQDEVKRESSNLQK
LQAQKQEAQETLNDLDEQKAKLEEQLNDIRQKCAEEAHLIAMLKAEITSQESKISAYEDE
LTKAQEELSRLQQETAELEHCIESGKAQLGPLQQHLQDSQQEINSVQTKLLELKELENNQ
FSWHSQPHSTLVNGTVDHSSLSNSSSETANLNENAERESIAEEEQTNSVSPVRNSPETAV
SVREEKETPAATVTKKEDPFDAESHPLPDLVSEASLEFFQSDPFVGNDPFKDDPFGKIDP
FGGDPFKGSDPFAADSFFKQSSTDPFVTAGTDPFSSADNSNNTTTEISKKNDPFAPGGTT
VTTSNDLATDPFASLFGSESFEGGFADFSTLSKANNEDPFSSSTSGSVSSVTITKNLFEE
APAKNEDVPPALPPKTGTPTRPCPPPPGKRPINQIDSSDSFKSSDPFQPFPTPDIPKEQE
ADLFCDPFAPTSISKEADPNNFANFSTYSTEEDMIEWAKRESEREEKERLARLKQQEQED
LELAIALSKSEISEA
NT seq 2748 nt   +upstreamnt  +downstreamnt
atggccgcgcgcctctccctggcacagctatcgagtgcaaatcctgtgtatgagaaattc
tatcgacaggttgattctgctaatgctggaagagtattagcttctgatgcagctgttttc
ttgaaaaagtctggattgacagatttggtacttggaaagatttgggacctagctgatact
gatggcaaaggtatcctgaacaaacaggagttttttgtggctcttcgacttgtagcctgt
gcacagaatggattggatgtttccctgagtagtcttaacttgcctgttcctccaccaaga
tttactgatactagcagtcctttgctactcagtggaacagcatcaagtgatctaccatgg
gctgtaaagctggaagacaaggtcaagtatgattctatttttgacagcctaaatccagtg
aatggactattgtcaggggataaggtgaaacctgtgctcctcaactcaaaactgccagtg
gatatcttaggacgggtgtgggagttgagtgatattgaccatgatggaatgttggatcga
gatgagtttgcagttgccatgtttttggtatactgtgctttggagaaagaaccagtgcca
atgtccttgcctgcagctttggtgccaccatccaagagaaaacctctcagtgttccagga
gcaatgccattaataccatcttctaccaaagagtctcatcagtcattgccacctgtgggc
attttagctgccaaaacaccattaacacagtgggttgtatcgcctgcagacaaaattaag
tacgatgagatctttgtgaaaactgacaaggacatggatggatttgtgtcaggtgtggaa
gccagagaactgttcctgaaaacaggactgccttctactctccttgcacatatctgggct
ctctgtgacaccaaggactgtgggaagctttcaaaggaacagtttgctttggctttccac
ttaattaatcagaagttaacaaagggcattgatcctcctcaggctctgactccagagatg
attccaccttcagacaggggtgtcagtttacagaagagtactcaaggaccgaattctgta
gcagatttttctgcaattaaagaacttgatacattaaacaatgaaattgtggacctgcag
agggaaaagaataatgtagagcaagacctcaaggagaaagaagatgccatcaagcagagg
acaagtgaggtccaggatctccaggatgaagtaaagcgggagagcagtaatctgcagaag
ctgcaagctcagaaacaggaagcacaggaaacccttaatgatcttgatgagcagaaggcc
aagttggaagaacaacttaatgacatcaggcagaagtgtgcagaggaggcccatttgatt
gccatgctaaaggctgaaataacaagccaggaatcaaagatttcagcttatgaagatgaa
ctgaccaaagcccaagaggagctgagtcgcctgcagcaagaaactgcagagcttgagcat
tgcatagagtctgggaaagcacagctgggacctcttcagcaacatctgcaggattcacaa
caggaaatcaattcagtgcagacaaagcttcttgagctgaaagaactggaaaataaccaa
tttagttggcactctcagccccatagtacacttgttaatggaactgtggatcattctagt
cttagcaacagcagcagtgaaactgcaaaccttaatgagaatgctgagagggaaagtata
gcagaagaggagcaaacaaacagtgtgtctccagtaaggaatagtcctgaaacagcagtt
tcagtaagggaagagaaagagaccccagcagcaactgttaccaaaaaagaagatccattt
gatgctgaatctcatccgttgcctgatctagtttctgaagccagcttagagttcttccag
tctgacccttttgttggcaatgatcccttcaaagatgacccttttggaaaaattgatccc
tttggtggcgatcccttcaaaggctcagacccttttgcagctgactctttcttcaaacaa
tcctccaccgacccttttgtgactgctggcactgatccatttagttctgcagacaacagt
aataataccacaacagagatatcaaagaagaatgacccttttgctcctggtggaactact
gtcactacatcaaatgatctagctacagacccctttgcctccctctttggaagtgaatcc
tttgaaggtggctttgctgacttcagcacgctgtcaaaggccaacaatgaggatcccttt
agctcttccacatcaggttctgtcagcagtgtcactataactaaaaacttgtttgaggaa
gcaccagctaaaaatgaggatgttcctcctgcactgccccctaagacaggaactcccacc
aggccctgtccacccccacctgggaaaagacctatcaatcaaatagactcttcagattcc
tttaagtcgagcgatccatttcagcctttccccaccccagacattcccaaagaacaagaa
gcagatctattctgtgatccatttgctcccaccagcatcagtaaagaggctgaccccaac
aattttgcaaacttcagtacttattctactgaggaagacatgattgaatgggctaagaga
gaaagtgagagagaagaaaaagaaagattggcaagactaaaacagcaagagcaagaagac
ttggaactggctattgcactcagtaaatctgaaatatcagaagcatga

DBGET integrated database retrieval system