KEGG   Taeniopygia guttata (zebra finch): 100226372
Entry
100226372         CDS       T01082                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tgu01002]
    100226372 (ADAMTS13)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100226372 (ADAMTS13)
Peptidases and inhibitors [BR:tgu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100226372 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_2 Peptidase_M10 DUF3810
Other DBs
NCBI-GeneID: 100226372
NCBI-ProteinID: XP_030142208
Position
17
AA seq 1392 aa
MRVGWALRALAVLPLGLCWLPQKFLGALDGEDVLSYFGTSSVPDVPEFVVAEPACPCKEE
HFGLRPCRVQHCSIQAWGQLYAFEFLEDHALLSSSFVSSQVVNSSFILLKRFPRSCFAGG
KALQPPGARSRVTFCEGQLQGVVTVGEEKVHIRPVRSKDVALLKDLGFSSPHILFKSAAR
EAKPARAGWAPPRLHKRAEAAVKHLELMVVAGPDVYLYHREDTERYILANLNIGAELLRD
ASLGAHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLY
ITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIAHDGE
GNVCSSSGYIMGSAGNHNSIDLTWSPCSREQFLALVSTGQTSCLNDLPDMDGSIPGWKPG
LYYGADEQCKIAFGSVATACTFADTNVDICKVLSCHVQPADKSSCTRLLVPLLDGTECGI
NKWCSKGQCSSLEELNPMAVVHGHWSAWSPLSPCSRSCGGGVVLRQRFCNNPRPAFGGQE
CHGASMQAEMCNTQACLMTQQDFMAEQCAATNLKPLYLDVETPSFYTWTSAVGFAKGDLL
CKHMCRAVGKEFMVSRGDNFLDGTRCEQDDTEHHGDLHLCVMGRCRAFGCDGQMGSRKAM
DACKVCGGENSTCTEVSGSYTEGKAKEYVTFLSLPYNTTSVHVTNRRPLFTHLAVKVKGE
YVVAGKGKISLNVTYPSVLEDNQIKYQVFLTQDNLPSLEEIHVDGPTQEEVEIQVYRRYT
KEYGNATNPDITFSYFVPRESLTYLWIPQQGPCSVTCGEGVQPVAHVCFDQTKNEVTEDQ
WCLELPQPLPEHKPCAMGPCLYRWKMSQRDECSAVCGTGVAQQNLTCVQFHDGLETVVDD
SLCPAEEKPLSLVPCVVNVCPLGWDKEEDAHSLQPLESLGHVQLENQTVYVWSPVAGECS
VSCGRGKTQLHYVCVAFDTKEETQEENCQPVPKPESRVEVCDLNPCPPRWKVTPAGPCSS
SCGLGLAVQLVTCVQTLHGQEVLQEEHLCPVAEKPLTSVPCVIRTCSYEWSFSEWSECST
TCGNGIQTRQDFCLSSLTHKPVNPLFCRRFPKAIVVRGCSAGPCPEQEGTQAPGAELQPV
PPATHLPTAAPEHRHKDLDVPLSAGPWEQTEPSGGVCGNLFLNATGIINMTGVESRDCTV
AIGRPLREEISVTILESSLNCSAGEVLLFSGRMMWRTGCRKLPLSLINSRTNTLIVKQRV
VLPGNGVILQYNSRTATKKYYQDCDQQLFGPQGEIVAPVERQEGVCRTFITVAPRQRISI
RALNTDLGPEGNQTDFNYILVRDVSTMKTVVFRGKQQFLWQSTGSQAEIEFHENVKDHRT
HFWAEYHAIEPK
NT seq 4179 nt   +upstreamnt  +downstreamnt
atgagggtcggctgggcgctgcgggcgctcgccgtgctgccgctggggctgtgctggctc
cctcagaagttcctcggcgctttggatggggaagatgttctgtcttactttggaaccagc
tcagtgcctgatgtacccgagtttgtggtggctgagccagcttgcccttgtaaagaagaa
cattttgggctgaggccctgtcgggtccagcattgctccatccaggcctgggggcagctc
tatgcctttgaattcctagaggaccacgccctcctttcctcctcctttgtgagcagccag
gtggtgaactcttcctttattttactgaagagattccccaggagctgctttgcgggtgga
aaagccctgcagcctcctggggccaggagcagagtcactttctgtgaagggcagctgcaa
ggagtggtcactgtgggtgaggagaaggttcacatcaggccagtcaggagcaaagatgtg
gctctgctgaaggacctcggcttctccagcccccacatcctcttcaaaagtgctgcaaga
gaggcaaagccagccagagcagggtgggctcctcctcgcctgcacaagagggctgaggca
gctgtcaaacatctggagctgatggtggtggcagggccagatgtttacttgtaccacaga
gaggacacggagcgttacatcctggccaacctgaacattggagcagagctgctcagagat
gcctcactgggggctcatttcagagttcacctcatgcaaatgctggttttgagagagcca
gaggcagaggtgaacatcaccaccaacatcacctcctccctcatcagtgtctgtgagtgg
agcaagaaggtgaacccccagaacgactctgacccccagcatgctgacattgtcctctac
atcaccagatttgacctggagttgcctgatgggaacaaggaacttcgtggagtgactcag
ttagggggagtctgctcctccttctggagctgtgtcattacccaggacactggctttgac
cttggagtcaccatagcccatgagattgggcacagccttggcattgcccacgatggagag
gggaatgtgtgcagcagcagtggttacatcatgggctcagcaggaaaccacaacagcatc
gacctcacctggtctccgtgcagccgggagcagttcctggcccttgtcagtacaggccaa
acaagctgcttgaatgacctgccggacatggacggcagcatcccggggtggaagcctggc
ttgtactatggagcagatgagcagtgtaaaattgcctttgggagtgtggccacagcttgc
acctttgctgacaccaatgttgacatctgtaaagttctctcgtgccatgtacagccagca
gacaaatccagctgtactcggcttctggttcccctcctggatggaactgagtgtgggatc
aacaagtggtgctccaagggtcagtgcagctctctggaggaactgaaccccatggctgtg
gtccatgggcactggtctgcctggagccccctctccccctgctcccgcagctgcggcggg
ggggtggtgctgaggcagcgcttctgtaacaaccccaggcctgcttttggggggcaggag
tgccacggtgccagcatgcaagcagagatgtgcaatacacaggcctgtctgatgacccag
caggacttcatggctgaacaatgtgcagcaacaaatttaaagccactgtaccttgatgta
gaaacaccatccttttatacctggacctctgctgttggctttgccaaaggggacctgctc
tgcaagcacatgtgcagggctgtgggcaaggagttcatggtgagccgtggggacaatttc
ctggatggaaccaggtgtgagcaggatgacacggagcaccacggggatctccatctgtgt
gtcatgggcaggtgcagagcattcgggtgtgatggccagatgggctccaggaaggccatg
gatgcctgcaaggtctgtgggggtgagaactccacctgcactgaagtgagtggatcctac
acagaagggaaagctaaagagtatgtgacatttctgtctctgccctacaacaccacctca
gtccatgtcaccaacaggaggcctctcttcacacacctggctgtgaaggttaaaggagag
tatgtggtggctggaaaaggaaaaatctcactgaatgtcacctacccgtcagtcctggag
gacaaccagatcaaataccaagtgtttctcacccaggacaacctgccaagcctggaggaa
atccatgtggatgggccaacacaggaagaagttgaaatacaggtctacaggagatacaca
aaagaatatggcaatgccaccaacccagacatcaccttcagctactttgtccccagggag
agcctgacctatctgtggattcctcagcagggcccctgttcagtgacctgtggggaaggg
gtgcagccagtggctcacgtgtgctttgatcagaccaagaatgaagtaacagaggatcag
tggtgtctggagctgccccagcccctcccagagcacaagccctgtgccatggggccgtgt
ctctacaggtggaagatgtctcagagagatgaatgctctgctgtctgtgggactggagtt
gcccagcagaacctgacctgtgtgcagttccatgatggcctggagactgtggtggatgac
agcctatgcccagcagaagaaaaacccctctcccttgtgccatgtgtggtcaatgtctgc
cctttgggctgggacaaagaggaagatgcacactcacttcagcctctggagtcacttggg
catgtccagctggaaaatcagactgtgtatgtctggagccctgtagctggggagtgttct
gtctcctgtggcagaggtaagactcagctgcactatgtttgtgtggcttttgacaccaaa
gaagaaacccaggaggaaaactgtcagccagtgccaaagccagagagcagggtggaagtc
tgtgatctcaacccctgcccaccaaggtggaaggtaacccccgctgggccctgctcctcc
agctgtgggctgggcttagcagtgcagctggtcacctgtgtgcagaccctgcatggccag
gaggtcttgcaggaagaacatttgtgtcctgtggcagagaagcccctcaccagtgtcccc
tgtgtcatccgcacgtgctcttacgagtggagcttcagcgagtggtcagagtgttcaaca
acctgtgggaatggcattcagaccaggcaggatttctgcctcagctctctgacccacaag
cccgtgaacccccttttctgccggcgcttccccaaggccatcgtggtgcgtggctgctcc
gcagggccctgtcctgagcaggaggggacccaggcccctggggcagagctgcagccagtg
ccaccagccacacacctgcccacagctgccccagagcacagacacaaggatctggatgtc
cctctgtctgctgggccctgggagcagacagagcccagtggaggtgtctgtggaaacctg
tttctcaatgccactggcatcatcaacatgacaggcgtggagagcagggactgcacggtg
gccatcgggcgtcccctgagggaggagatctcggtgaccatcctggagagctccctcaac
tgcagtgcaggtgaggtcctgctgttttctgggcgaatgatgtggcggacaggctgcagg
aagctccctctgtccctgataaattccagaaccaacacactgattgtgaaacagcgtgtt
gtgctgccaggaaacggggtcattctgcagtacaacagcagaactgcaaccaaaaaatat
taccaagactgtgaccagcagctgtttggcccccagggtgaaatagtggctcctgtggag
aggcaggagggggtgtgccgcactttcatcacggtggctccacggcagcgcatctccatc
cgtgccctcaacactgacctgggccctgagggcaaccagactgacttcaactacatcctg
gtccgagatgtcagcaccatgaagactgtggtgttccgtgggaagcagcaattcctttgg
cagtcaacaggaagccaagctgaaattgaattccatgaaaatgttaaggatcacagaact
catttctgggctgaatatcatgctattgagcccaaataa

DBGET integrated database retrieval system