KEGG   Taeniopygia guttata (zebra finch): 100230839
Entry
100230839         CDS       T01082                                 
Symbol
DNAH3
Name
(RefSeq) dynein heavy chain 3, axonemal isoform X1
  KO
K10408  dynein axonemal heavy chain
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
KEGG Orthology (KO) [BR:tgu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:tgu03037]
    100230839 (DNAH3)
   04812 Cytoskeleton proteins [BR:tgu04812]
    100230839 (DNAH3)
Cilium and associated proteins [BR:tgu03037]
 Motile cilia and associated proteins
  Dynein arm
   100230839 (DNAH3)
Cytoskeleton proteins [BR:tgu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100230839 (DNAH3)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_22 T2SSE Sigma54_activat DUF3855
Other DBs
NCBI-GeneID: 100230839
NCBI-ProteinID: XP_030140606
Ensembl: ENSTGUG00000009160
Position
14:complement(840923..898401)
AA seq 4050 aa
MLRNTKETQNNSVCNMSRPKQSLKLSFLRTPAPASASVAPSDLHELVLQKARYPPLMQES
SWTLAAPFKEQHHYRNPSDSIANNYTLTAQDLKMKNIKKMKSFSMVEISQSSLSARKKRR
WSSDSTLLKTVSRISLSVPAHTPELHVINYTNNQPLTPEEQFALMDLHEKEISKREKLPS
SDDLERYCHYIYNGVREDMLAPQDKEVVNKILKHIPTHILPSPELEKSVACLKEEIRKDY
SISLMKAIVDYVLLDPAERKRLSIQSTPHPFPRRVVCAPVPWHSSYKETKSWNESNLFIV
NSMMPTLQELWLSQYSHLRFVRTAEVLCGHLPLLPAEFVDIIQRHCVEARDILQHKWIPT
CASLFIDQRHMWLHFAPQRDSDSSEKAESYFSSVAALMSLQLREMVINSLEDLLAFFMIH
KDGNDFKEPYQGVQFFLSQILTVKLLVKEPDIVFEPPLGACWDLISHCFRKILQSAEELP
KVEKLLFPELRRDDLTLNTVKPHESLFLEYINKLEKIFESNILGPKKYLNVYRKYSNLLN
NKSQQDVSKFLEKVPSLDALTEKIDSFTKLKEEIASMDITVPLAMFCLDTLQLNEELCNR
TQNLKDTLIEFEVMENRQLNQRICDDFDFIAKRMSEVPQNTEQLVEYEAFLKKSSEVTVV
KLKKDLDKAAHRLQILMDYADLSDEDINLNSAVFHWPDEIRKIFESSKNVLTERRAQVEK
ALFERSSQFKTTLEGYYKEVESYKKRGDIVTAEELRKNTENFKKLNKNIDSALAEFEGIN
YEEDLLGQEKTQFPLLQSIIATKEPFEQLWVTAYTFHTKSEEWMNGPLQQLNADEINEEV
GNMWRTMYKLSKSFPDVPVPRRMAESMKFKLDKFKQHLPVLSIACNRGMKERHWEQISEI
VGCEIKPDKDTNLKYMLECGLSKFIEQIEPVGAAASKEYSLEKSIEKMKSEWVNVHFGLA
KYRDTDTNILSAVDDIQLLLDDHIVKTQTVCGSPFIKPIEAECVAWRDKLCLMQDIIDSW
LKCQATWLYLEPIFSSEDIIAQMPEEGRKFKIVDSYWKNIMTEVVKDTKVLVATEQPKML
DRLQEANILLEDIQKGLNTYLESKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCF
EGIAKLEFTEDLEIIGMISSEKETVPFIDKIYPMRANGMVEKWLLQVEEMMLASVRQVLQ
DGIKGYSQVPRKEWVLQWPGQAVICVSSIYWTEEVSEAIRKKALQDFLEKSNTQIRDIVE
LVRGKLSSGARLTLGALIVIDVHARDVVSKLVEDKVTDLNDFQWISQLRYYWAENDVIVR
MITTEMKYGYEYLGNSQRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLA
KAIAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQ
AIIRKLKKFIFEGTEISLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIG
EISLYSMGFLDSKSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPTE
NESVLLLRALLDVNLAKFLSQDVPLFQGIISDLFPGVVLPTPDYDLFIKALTENIEKLNL
QPVPWFIGKIIQVYEMMLVRHGFMIVGDPMSGKTSSYKVLAGALADLCAANTMDEFAVEY
KVINPKAITMGQLYGSFDPVSHEWSDGILAKAFREQASSTTDDRKWIIFDGPVDAVWIEN
MNTVLDDNKKLCLMSGEIIQMSPKMSLIFEPADLEQASPATVSRCGMIYMDPQQLGWQPL
KDSYLKTLPPNLQEEHRELVNNLFMWLVEPCLDFIDHHCKFVVKTSSLHLSYSLMKLYSS
LLDEIKESDEEDSETMSDQQITSWLQALFLFALVWTVGGIIDANSRRKFDLFYRNLLNGM
NEQNPRPKNVKLNKNNIFPEKGSVYDFYFNKHGHGQWTMWTDYITKEEQVIAPTAKVSEL
IIPTMETARQMYFLKTYVEHSVPLLFVGPTGTGKTAITNNFLLKLPKEKYIPSFINFSAR
TSANQTQDIIMSKLDRRRKGLFGPPAGKEAIIFVDDLNMPEKEVYGAQPAIELLRQWIDH
GHWYDRKDASHISIIDVLLVTAMGPPGGGRNDITGRFTRHLNIVSICAFSDDILTKIFTA
VTDWHFSKGFDASFLRLGKMMVQATSVLYKLAVDNFLPTPSKSHYVFNLRDFSRVIKGVL
LCPHTHLQDGDKLIRLWVHEVYRVFYDRLVDDDDKNIFFQMVQETTLNSFKQNFNKVLSH
LSPTGKVTDDNIRALFFGDYLKPSSSVKIYDEITDLKQLTSVMEFYLEEYNNISKAPMSL
VMFQFAIEHISRICRVLKQDNGHLLLVGVGGSGRQSATKLATFMNSFELFQIEISKSYGI
SEWKDDIKQVMLKTGVGNNNVSFLFCDNQIKDESFVEDINMLLNTGDVPNIFAADEKAEI
VEKMQNAARLENRKIEATPLAMYSFFIERVKKNLHIVLAMSPIGDAFRNRLRMFPSLINC
CTIDWFQTWPTDALEMVANKFLEDIELKDDIRKEVVSVCKYFQESVRELSVGYYATLRRH
NYVTPTSYVELILTFKTLLNRKREEVDMMRTRYLVGLEKLEFASSQVADMQKELTDLQPE
LIKTSAETDKMMVKIEKETVEVDAKKAIVSADEKEANDAAAVAQGIKDECEADLAEALPA
LEAAEAALNTLNPSDITLVKSMQNPPAPVKLVMESICIMRSIKPERKPDPSGSGKMIEDF
WGPAKKLLSDIKFLDRLKSFDKDKIPPAIMKKIREKFMNHPDFQPEVVKNVSSACEGLCK
WVRAMEVYDRVQKVVAPKRERLQEAEAILDVQMQKLQVKQAELKEVVDRLQALQDEFDAM
NNKKIELENNIERCSQKLVRAEQLISGLGGEKERWTEAARLLGIQYIDLVGDVLLSSGTV
AYLGAFTVDYRLQCQKQWQDLCIEKNIPCSSDFSLSNTLGDPVKIRAWQIAGLPVDSFSI
DNGVIVSNSRRWALMIDPQRQANKWIKNMEKTNKLSVIKLSDTHYVRTLETALQLGTPVL
LENIGEELDAFLEPILLKQTFKQQGVEYMKLGENIIEYSRDFRFYMTTHLRNPHYYPEVA
VKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLILESAANKKQLKELEDKILEVL
SHSEGNILEDETAINILSSSKQLSAEISEKQQIASVTEKEIDSTRMGYKPVAVHSAVVFF
CISDLANIEPMYQYSLIWFINLYVQSIAKSRKSGRLQERIKNITDHFTVSIYNNVCRSLF
EKDKLLFSFLLTVGIMKGKGQIDDAVWRFLLTGGVALDNPHPNPAPDWLSNKSWAELVRA
SCLTSLQGLMEHVRDNSSKWKPIYDSVRPHEEAFPDDWNSLTGLDRMVILRCLRPDKIIP
AVQIFIVENMGRTFIEPPTFDLGRSYSDSNCCAPLIFILSPGADPMAGLLKFADDVSMGS
SSIQTVSLGQGQGPIAEKMIYQAITDGTWVVLQNCHLATSWMPALEKICEEVIVPENTND
KFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGVRVNLLRSYLNDPISDPVFFKSCQKPKL
WQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMQQIQMFLNEYEEIPFEALT
YLTGECNYGGRVTDDKDRRLLLSLLSIVYNKDIEQEKYMLSAGSDYYIPPHGPYESYVEY
IRSLPITTHPEVFGLHENADITKDNQETNQLFHAVLLTLPREAGGAGKSPQEVVEDLAQD
ILSKLPSSFDMEEVMKAYPVLYEESMNTVLRQELIRFNRLTEVVRSSLINIGKAIKGQVL
MSSELEDVFNSILIGKVPSMWAAKSYPSLKPLGSYVSDLLCRLEFFQEWVDKGPPTVFWL
SGFFFTQSFLTGVLQNFARKYTIPIDHIGFEFEVMKQEHTMEKMPEDGAYVRGLFLEGAR
WDRESLVIGESLPKILYDPLPIIWLKPGESSRFRHLNIYSCPVYKTSERRGVLSTTGHST
NYVLSIELPSDKPQKHWINRGVAALCQLDD
NT seq 12153 nt   +upstreamnt  +downstreamnt
atgctgaggaataccaaggagacacaaaacaattctgtgtgcaatatgagtcgcccaaaa
cagtcactgaaattatcattcctacgcacgcctgcacctgcttctgcttcagttgcacct
tcagacttgcatgagcttgtccttcagaaagcccgttatcctcctttgatgcaggagtca
tcatggactttggcagctccattcaaagaacagcatcactaccgaaacccaagtgattct
atagctaataactacactcttactgcacaggatttaaaaatgaaaaatataaaaaaaatg
aagtccttttcaatggtagagatatcacagtcttcactgtctgcaaggaaaaagcggcgc
tggagttctgacagtactttgttaaagactgtgagtcgcatttcactgagtgtacctgct
cacacaccagaactgcatgtcataaattatacaaacaaccagccactgactccagaagaa
caatttgctctcatggatttacatgagaaggagataagtaagcgagaaaagctaccttca
agtgatgatttagagcggtactgtcactacatatataatggagtgcgagaagatatgctg
gcacctcaggataaggaagtggtgaataaaattttaaaacatattccaactcacattctt
cctagcccagagctagagaaatctgtggcatgtttaaaagaagagattagaaaagactat
tctatcagcctcatgaaagccattgttgattatgtcttgttggatccagctgagaggaag
agactctctattcaaagcaccccacacccttttccccggagagttgtctgtgcaccagtc
ccatggcacagctcttacaaagaaacaaaaagttggaatgaaagcaatctgttcatagtg
aattcaatgatgcccactttgcaagagctctggctttctcaatacagccacctccggttt
gttcgcactgcagaggtgctctgtggacacctgccactgctgcctgcagagtttgtggac
atcattcaaaggcattgtgtggaagctcgtgatatccttcagcacaagtggattccaact
tgtgcatctctttttattgatcagagacatatgtggcttcattttgctcctcaaagggac
tctgattcctctgagaaagctgaaagctattttagctctgtggcagctctaatgtcatta
caattgcgtgagatggttattaactccttagaagatcttcttgcattttttatgatccac
aaggatggaaatgactttaaagaaccatatcaaggagtgcagttcttcctatcacagata
ctcacagtcaaactccttgtgaaagagcctgatattgtctttgagccacctttgggagca
tgttgggatttaatcagtcattgcttcaggaagatcctgcagagtgctgaggaactccca
aaggtagagaaacttctatttccagaattacgaagagatgatctcactcttaatacagtc
aaaccacatgagtcgttgtttttggagtatataaacaaacttgaaaagatctttgaaagc
aacatacttggtccaaagaagtatttaaatgtgtacaggaagtacagcaatcttttgaac
aacaaatcacagcaagatgtctcaaaatttttggaaaaagttccttctttagatgcttta
actgagaagattgacagcttcacaaaactgaaagaagagattgcttctatggatatcacg
gttcctctggccatgttctgtctggatactttacaactgaatgaggagctctgcaatcgg
acccagaatctcaaagatacattgattgaatttgaagtgatggaaaacagacagttaaat
caaagaatttgtgatgattttgactttattgcaaagagaatgagtgaggtgccccagaac
actgaacagctagtagaatatgaagcattcttgaagaaatccagtgaagttactgttgtt
aaactgaaaaaggatcttgacaaagcagcacacaggctgcaaatcctcatggactatgct
gatctctctgatgaggacataaacctgaacagtgcagttttccattggcctgatgagatt
aggaaaatatttgaaagcagtaaaaatgtgttgactgagaggagggctcaggtggagaag
gcattgtttgaaaggtcttctcagtttaagacaactcttgaaggttattataaagaagta
gaaagctacaagaagcggggagatattgtgactgcagaagaattgaggaagaatactgag
aatttcaaaaagttaaataagaatatagatagtgcactagcagaatttgagggtattaat
tatgaagaagatttgcttgggcaggagaagactcaatttcctctcttgcaatctataatt
gcaaccaaagaaccttttgagcagctttgggtaacagcatatactttccataccaaatct
gaggaatggatgaatggacctcttcagcaattgaatgctgatgaaattaatgaagaggtt
ggaaatatgtggagaaccatgtacaagctcagtaagagcttcccagatgtgccagtaccc
aggcgcatggcagaatccatgaaattcaagcttgataaatttaaacagcatcttcctgtc
ctgtccattgcctgcaatcgtggaatgaaggagagacactgggagcagattagtgaaatt
gtaggatgtgagatcaaaccggataaagacactaaccttaaatacatgttggaatgtgga
ctttcaaaatttattgaacaaatagaacctgttggagcagctgcaagtaaggagtattcc
ttagagaaatcaatagagaaaatgaaatcagagtgggtcaacgtgcacttcggtttggcc
aagtacagggatactgacaccaacatcctgtcagcagtggatgacatccagcttttgttg
gatgatcacattgttaagactcagacagtgtgtggctctcccttcatcaaaccaatagaa
gctgaatgtgtggcttggagagataagctgtgtttaatgcaagatattatagatagctgg
ttaaaatgtcaggcaacatggttgtatttggaaccaatttttagttcagaagacattata
gctcaaatgcctgaagagggcagaaagtttaagattgtggattcatactggaaaaacatt
atgacagaagtggtgaaagacacaaaggtacttgtagcaactgaacaacccaagatgtta
gacagacttcaggaagcaaatattctcttagaggacattcaaaaggggctgaatacttac
ttggagtcgaaaagattatttttcccaagattctttttcctgtctaacgatgagctgctt
gaaatactgtctgaaacaaaggatccacttcgagtacaaccacatttaaagaagtgtttt
gaaggaattgctaaactggagttcacagaagatctggagatcataggcatgatcagttca
gagaaagaaacagttcctttcatagataaaatctatccaatgagagcaaatggcatggta
gaaaaatggcttctgcaagtagaagaaatgatgttggccagtgtaagacaagttcttcaa
gatggcataaaaggatatagccaggttcctcggaaagagtgggtacttcagtggcctgga
caggcagttatttgtgtttcatccatttactggacagaagaagtgtctgaggctataagg
aaaaaagctttacaagatttcttggagaagagcaatacacagatcagggacatagttgag
ttagtgagaggaaagctgtccagtggagcccggctgacccttggagctctcattgtcatc
gatgtgcacgcccgtgatgtggtctcaaaattggttgaagacaaagtcacagatctgaat
gacttccagtggatttctcagctgagatactactgggcagagaatgatgtgatagtgcga
atgatcacgacagaaatgaaatatggttatgagtatctgggcaattcccaacgtctggtt
ataaccccactgacagatcgatgttataggacattaatgggtgccttgaaattaaatctt
ggtggtgctccagaagggcctgctgggactggcaaaacagaaacaacaaaagatctagca
aaagctatagctaagcagtgtgttgtttttaattgctccgatggcctcgattacaaggca
atgggcaagttctttaaggggctggcacaagctggggcatgggcctgctttgatgagttc
aacaggattgaggtagaagtattatcagtagttgcccagcaaatacttagcatccagcaa
gctataattcgcaaactgaaaaaattcatctttgaagggacagagatctctcttaatccc
acatgtgctgtgtttattaccatgaatcctggctatgctggacgggcagagttgcctgat
aatctgaaggcactgttccgaacagttgccatgatggtcccagattatgccttgattggg
gaaatctcactttattcaatgggatttctggactccaagagtcttgcccagaaaattgtt
gccacttaccgtttgtgctcggagcagttgtcatctcagcaccactacgattatgggatg
cgcgcagtgaaatctgtcctgacagcagcagggaacctaaaactgaagtaccccactgaa
aatgaaagtgtgttgttgcttcgggctttgctggatgttaatttggccaagttcttgtcc
caggatgtgccattgtttcagggtatcatatctgacctgtttcctggagtggttcttcct
acaccagactatgacctatttatcaaggcactaactgaaaatattgaaaaattgaatctt
caaccagtgccatggttcattggaaaaattattcaggtgtacgaaatgatgctggtgcgc
cacggtttcatgattgttggagatcctatgagtgggaagaccagttcatacaaagtgctg
gctggagccctggctgatttgtgtgcagcgaacactatggatgagtttgctgttgaatac
aaagttattaatcccaaagccattactatggggcagttgtatggcagttttgatcctgta
agccacgagtggtcagatggaattcttgcaaaggccttcagggaacaagcatcttctacc
acagacgatcgcaagtggattatttttgatggccctgtggatgcagtttggatagagaac
atgaacactgtgctggatgataataaaaagttatgcttaatgagtggtgaaataattcag
atgagcccaaaaatgagtttaatctttgagccggcggacttggagcaggcatctccagca
actgtcagcaggtgtggtatgatctatatggacccacaacagttaggctggcagccactg
aaggattcctacctgaaaactctgcctccaaacctgcaggaagaacaccgagagctggtc
aataacttgtttatgtggctagttgagccttgtttagattttattgaccatcattgcaaa
tttgtggtaaaaacatcctctcttcacctgagttacagcttgatgaaactctattcttct
ctccttgatgaaataaaggaatctgatgaagaggacagtgaaaccatgtctgatcagcag
atcacctcgtggctgcaggcccttttcctttttgctttggtgtggacagttggagggatc
attgatgcaaacagcagaagaaaatttgatttgttttaccgcaacttgctcaatggaatg
aatgagcaaaacccacggcctaaaaatgtgaagcttaacaaaaacaatatcttcccagaa
aaagggagtgtttatgacttctattttaacaagcatggccatgggcagtggaccatgtgg
acagactacatcacaaaggaagagcaagttattgccccaacagctaaggtatctgagctg
atcattccaacaatggaaactgccagacaaatgtattttcttaaaacatatgtggagcat
agtgtccctttgctttttgtgggtcccactggcactggaaaaacagctataacaaacaac
tttctactgaaacttccaaaggaaaaatacatcccgagtttcatcaacttctctgcaaga
acctctgctaaccagacccaggatattattatgtccaagctggacagaagaagaaaagga
ttatttggacctccagcagggaaagaagctataatttttgtggatgacctaaacatgcct
gaaaaggaagtgtatggagcccagccagctattgagcttctcaggcaatggattgatcat
gggcactggtatgacaggaaggatgcatcccacatcagcatcatagatgtcctgctggtc
acagctatgggtccccctgggggaggcaggaatgacattacaggacgcttcacacggcac
ttgaatattgtctctatctgtgctttcagtgatgacattttaaccaagatttttactgca
gttactgactggcacttcagcaaaggctttgatgcttcatttctgaggctgggtaagatg
atggtccaagcgacgtcagtgctttataaattggcagttgataattttctcccaactcct
tcaaaatcccactatgtctttaatctacgggatttttccagggttattaaaggagttctg
ctctgtccacacactcatttgcaagatggagataaactgatcagactttgggttcatgag
gtttacagagttttctatgatcgcttggttgatgatgatgacaagaacattttctttcag
atggtacaagagacaacattaaatagcttcaagcagaactttaataaggtactgagtcat
ctctcacctactggaaaagtcactgatgataatattcgcgccctgttctttggagactat
ttaaagccgagcagttctgtcaaaatttatgatgaaatcacagacctaaagcagctgaca
agcgtgatggaattctaccttgaggaatacaacaatatcagcaaggccccgatgtccctg
gtcatgttccagtttgctattgagcacatctccaggatatgcagggtgctgaaacaggat
aatggacacctgctgttggtgggcgttggcgggagcggccggcaaagtgcgaccaagctc
gccaccttcatgaattcctttgagctcttccagatcgaaatttccaagtcctatggcatc
agtgaatggaaagatgatattaaacaagtcatgctgaaaacaggtgttggtaacaacaac
gtgtcctttttgttctgtgataatcaaataaaggatgaatcatttgtagaagatatcaac
atgcttttaaatactggagatgtgcccaatatctttgcagcagatgagaaagctgaaatt
gttgagaaaatgcaaaacgcagcaaggttggagaacaggaaaattgaagccacgcccctt
gctatgtacagtttctttattgaaagggtgaagaaaaacttgcatattgtcttagccatg
agtcctattggagatgcatttcggaatcgattacggatgttcccttcgctgataaactgc
tgcaccattgattggttccaaacctggcctacagatgctttggaaatggttgctaacaag
tttttagaggatattgagctcaaagacgacattaggaaagaggttgtgtcagtgtgcaaa
tatttccaagaaagtgtgagagaactctctgttggctactatgctacgctgcgcagacac
aactacgtgacaccaacttcctacgtggaactgattctcaccttcaagaccctgctgaat
agaaaaagggaggaagttgacatgatgaggactcgttatcttgtgggacttgaaaagctt
gaatttgcatcttcacaagttgcagacatgcagaaagaactgaccgaccttcagcctgaa
ctgattaaaacatctgcagaaacagataaaatgatggtcaagattgaaaaggaaaccgtt
gaagtagatgcaaaaaaggcaatagtgtcagcagatgaaaaagaggccaatgatgcagct
gctgttgcccagggtattaaggatgaatgtgaagcagaccttgcagaggctctgccagct
ctggaggcagcagaggcagctcttaacaccctgaatccttcagacatcactcttgtgaaa
tccatgcaaaatccacctgctcctgtcaaactcgtcatggagagtatttgtatcatgagg
tcaattaaaccagagaggaaacctgaccccagtggcagtggtaaaatgattgaagacttc
tgggggccagccaaaaaacttctttcagatatcaagtttcttgacagattaaagtcattt
gacaaggacaaaattcctcctgctataatgaagaaaattagagagaagtttatgaatcat
ccagattttcagccagaggttgtaaaaaacgtctcatctgcctgtgaaggcctttgcaag
tgggtgcgagccatggaggtctatgaccgtgtgcagaaagtggttgccccgaagcgcgag
cgtctgcaagaggctgaagccatcctggacgtccaaatgcagaagctgcaagtgaaacaa
gcagaactaaaagaggttgttgatcgccttcaagctttgcaagatgagtttgatgcaatg
aacaataagaagatagagttagagaataatattgaacgttgctcacagaagcttgtgaga
gctgaacagctgatcagtggcctgggtggagagaaggagaggtggacagaagctgcacgg
ttattaggaattcagtacatagacctagtaggggatgtgttgttgtcatcaggaactgtg
gcttatttgggagcctttactgttgattatcgcctacaatgtcaaaagcagtggcaggat
ctgtgcattgaaaagaacattccctgctccagtgattttagcttaagtaatacgttggga
gacccagtcaaaatccgtgcatggcagattgctggattgccagttgattctttttccatt
gacaatggtgtaattgtttctaactcaagaagatgggctttaatgatagatcctcaaagg
caagctaacaagtggataaaaaatatggagaaaactaacaagctgtcagttattaaatta
tctgacacgcattatgtgaggacattagaaactgctcttcagcttggaacaccagtcttg
ctagaaaatattggtgaagaattagatgctttcttagaacctattttattaaagcaaaca
ttcaaacaacaaggagtagaatacatgaaattaggggaaaatataattgaatattcaaga
gacttcaggttttacatgacaacccacttaagaaatcctcattattatcctgaagtagct
gtgaaagtttgtctactcaatttcatgattacacctttgggtcttcaggaccagcttctt
ggaattgtagctgcaaaggaaaagcctgagctagaagaaaagaaaaaccaactcattcta
gaaagtgcagccaataagaaacaactaaaggagttagaagataaaatcctggaggtcctt
tcccattcagaaggaaacatcttagaggatgaaacagcaattaatattttgtcttcatcc
aaacagttatctgcagaaatctctgaaaagcaacaaattgcctctgtaactgagaaggaa
atagattctactcgaatggggtataagccagttgctgttcattcagctgttgtcttcttc
tgcatctctgatctggctaacattgaacctatgtaccagtattcattgatttggttcatt
aacttgtatgttcaatctattgctaaaagcagaaagagtggacgtctacaggagagaatt
aaaaatataactgaccatttcacagtaagcatctataataacgtctgtcgttccctgttt
gaaaaggacaagctgttattctccttccttctaacagtaggcattatgaagggaaaaggc
cagatagatgatgcagtttggcgtttcctactgacaggaggtgttgctcttgataatcct
caccccaatccagctccagactggctgtctaacaaatcatgggccgagctcgtacgtgca
tcttgcctgaccagcctgcagggactaatggaacatgtaagagacaattcttccaagtgg
aagccaatctatgactcagtcaggccccatgaggaagccttcccagatgactggaactca
ctgacagggttagatcgcatggttattctcaggtgtttgcgacctgacaaaattatcccg
gcagtgcagatcttcattgtggaaaacatgggaagaacatttattgaaccacctacattt
gatcttggaagaagttacagtgactcaaattgctgtgcccctttgatttttatattatca
cctggtgctgatcctatggcaggtttgctaaaatttgctgatgatgttagcatgggaagt
tcaagcattcaaactgtttcactgggccagggccagggcccaatagcagaaaaaatgatt
taccaggctattactgatggaacctgggtagtgttacaaaactgccatcttgcaaccagc
tggatgcctgccttggaaaaaatctgtgaggaagttatagtgcctgagaataccaatgat
aagttcaggttgtggttaactagttatccatcagaaaagtttcctgttagtatcctccag
aatggcatcaaaatgacaaatgagcctccaaaaggcgtgagagtgaatctccttcgttca
tacctgaatgatcccatctctgaccctgtgttttttaaaagctgccaaaagccaaaattg
tggcaaaaaatgctttttggtctttgcttttttcatgctgttgtgcaggaaaggagaaac
ttcggcccactgggttggaatattccatatgaatttaacgagtctgacctcagaatcagt
atgcaacagatccagatgtttctgaatgaatatgaagaaatcccatttgaagctctgacc
tatctaacaggggagtgtaactatggaggtagagtaacagatgataaagacaggcgtctt
ctcctgtcccttctttccatagtctacaacaaggacatagagcaggagaagtacatgctt
tcagctggaagtgactactacataccaccacatggcccatatgagtcttatgttgagtac
atacgaagtttgccaattacaacacaccctgaagtgtttggacttcatgaaaatgcagac
atcaccaaggataaccaggagaccaaccagcttttccatgcagtgctcctgactttgcct
agagaagcagggggagctggcaagtcccctcaggaagttgttgaagatttggcacaggac
atcctatccaaactaccaagtagcttcgatatggaagaagtgatgaaggcatacccagta
ctttatgaagagtccatgaacacagttcttaggcaagaactaattagatttaacaggctt
actgaagttgttcggagcagcctcattaatataggcaaagccattaaaggccaagtgttg
atgtcttctgagcttgaagatgttttcaacagcatactaataggaaaagtgccatcaatg
tgggctgccaaatcctatccatcactgaagcctctgggaagttacgtgtctgatctcctc
tgtcgtttggagttcttccaggaatgggttgacaaggggccacccacagtcttttggctc
tcaggattcttcttcactcagtcttttttgactggtgttttacaaaactttgccagaaaa
tataccatcccaattgaccacattggatttgagtttgaggtgatgaaacaggagcacaca
atggagaaaatgccagaagatggggcttatgtgagaggcctttttctggaaggtgcacga
tgggatagagaatccttggtaattggagaatcactaccaaaaatcctctacgatcctttg
cccataatatggctgaaacctggagaaagttccagatttcgtcatctgaacatctactca
tgccctgtatataagacaagtgaaagaagaggtgtcttatccaccactgggcactcaacc
aactatgttctgtcaattgaactcccttcagacaagccccagaaacactggataaatcga
ggtgtggcagccctgtgccagctggatgactga

DBGET integrated database retrieval system