KEGG   Taeniopygia guttata (zebra finch): 100231154
Entry
100231154         CDS       T01082                                 
Symbol
MAGI2
Name
(RefSeq) membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 isoform X1
  KO
K05629  atrophin-1 interacting protein 1
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 MAGI_u1 WW Peptidase_M50 Guanylate_kin DUF6288
Other DBs
NCBI-GeneID: 100231154
NCBI-ProteinID: XP_012424302
Position
1A:10960100..11659386
AA seq 1536 aa
MSKGLKKKSHWTSRVHEIVIVRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYEGGSKL
VPEELLLEVNETPVAGLTIRDVLAVIKHCKDPIRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPGAEGKRKRNKSVSNMEKTGIEPPEEEEEERP
VVNGNDVTVTPESSEHEEKSTAVLGEASTTQPCPAPGYGQPEEAKEDMDVTKQTKPEEND
DLGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDD
PIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPNAELGTKPMQAQGFREKPLFTRDASQ
LKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEV
CVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAVMERPPVVVNG
RHNYETYLEYISRTSQSVPDVTDRPPHSLHSIPADSQLDSTFPPPAHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHA
EVVDILKECPVGSETSLIIHRGGFFSPWKTPKPMMERWENQGSPQTSVSAPAMPQNIPYP
PTLHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVLPRTGFRADSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHNAARNGQVNLTVRRKVLPTESSSQKGAPTPGATPPRSSPSARKMANNQGEPCPE
NGRSPGSVSTHHSSPRSDYTTYANSNHAASGSSATPPEGFASHSLQTSDVVIHRKENEGF
GFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADI
VKLIKDAGLSVTLRIIPQEELNSPASAPSSEKQSPMAQQHSPMAQQSPLAQQSPVAQHSP
VAQPPPPQPLQPQGHENSYRSEVKARQDVKPDIRQPPFTDYRQSSADYRQPPLDYRHPPV
MDYQQPPPLDYRQPPLMDYRQHSPDTRQFPLSEYRQPQDFDYFTVDLEKGAKGFGFSIRG
GREYKMDLYVLRLAEDGPAVRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRL
LLKRGTGQVPEYDEPNSWSAPSATAPGLPEVALSLDDIISPLSSSHIAPPSDPSHQISPE
PTWDIKREHDIRKPKELSVNGHKKKRLGEQRERSASPKKVDRSKHEEASWKGYSGGKSKT
TDGGRPTSESKAVGHSVMIEAGAREHVCAGTSDEQFGRLRKPESKRGGSLSKKDHRSTNT
CEKSAAAPDHVKTDTGATKTYSSNRCSSPGSDMDHSQRDPDGKPSEFPRKGHLHSISTRS
TNTTVRKATVSPGPWKIPGSDKLPSVLKSGTSAMSR
NT seq 4611 nt   +upstreamnt  +downstreamnt
atgtccaagggcttgaagaaaaaaagccactggacgagcagagtccacgagatcgtgatc
gtgaggaacccggagggacagctgggcttcgagctgaaggggggcgccgagaatggccag
ttcccctacctgggggaagtgaagcccggcaaggtggcctatgagggcggcagcaagttg
gtgccggaggagctgctgctggaggtaaacgagacccccgtggccgggctcaccatcagg
gatgtgctggccgtgatcaagcactgcaaggaccccatccgcctcaagtgcgtcaagcaa
ggaggcatcgttgataaggaccttcgtcactacctcaatctacggttccagaaaggctca
gtggaccatgagctccagcagatcataagagacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggggaagtccctggtgtggactatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtggaacatatgaagac
aactattacggcactccaaagcctccagcagaaccggctccgttgctgttaaatgtgaca
gaccagatcctcccaggcgccactcccggggctgaaggcaaacgtaaaaggaataagtct
gtgagcaatatggagaagacaggcattgaaccaccagaggaagaagaggaagaaagacct
gtggtcaatggaaatgacgtgacagtaacaccagaatcaagtgaacatgaagagaagagt
acagctgtcttgggtgaggcatctaccacccagccttgtcctgcaccaggatatggtcag
cctgaagaagcaaaggaggatatggatgtaacaaaacagactaaacctgaagagaatgat
gacttgggcccactgcctgataactgggaaatggcttatacagaaaagggggaagtctac
tttattgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggct
aaacctccagaagagtgcaaagaaaatgagcttccatatggctgggagaaaattgatgat
cccatttatggcacttattatgttgaccacataaatagaagaactcaatttgaaaaccct
gtcctagaagcaaaaaggaagctacagcagcataacatgcccaacgcagaacttggaaca
aagcctatgcaggcccaaggtttccgagaaaaaccactcttcacccgtgatgcatcacag
ctgaaggggactttcctcagcacaactcttaagaaaagcaacatgggttttggatttacc
atcattggtggggatgagccggatgagtttctccaggtgaagagtgtaattcctgatggg
cctgcagcacaagatgggaaaatggaaacaggtgatgtgattgtctatattaatgaagtt
tgtgtccttggacatactcacgcagatgtagtcaaactcttccagtctgttcctattggt
cagagtgtcaacttggtgctatgtcgtggataccctttgccctttgatcctgaagatcct
gccaacagcatggtgccaccccttgcagtaatggagaggcctccggtagtggtaaatgga
agacataactatgaaacttatttggaatacatttctaggacttctcagtctgttccagac
gtaacagatcgaccaccacactccttgcactccattccagcagatagtcagcttgatagc
acattcccaccacctgcccatgatgataatgtatcaatggcttcttctggggccacccaa
gctgaactcatgaccttaaccattgtgaaaggggcccagggctttggcttcactatagca
gacagtcctacaggacagagggtgaagcaaattctagacattcagggatgtcctggtttg
tgtgaaggtgacctcattgttgagatcaaccagcagaatgtacagaacctgagccatgca
gaagtagtggatatacttaaagaatgtcctgttggaagtgaaacttctttgattatccat
agaggaggtttcttttctccatggaaaactccaaagcctatgatggaacgatgggagaat
caaggcagccctcaaacaagtgtgtctgctccagctatgccacagaatattccctatcca
cccactcttcacaggagttcatttcctgattcaacagaggcctttgatccacgaaaacct
gacccgtatgagctgtatgagaaatcaagagctatttatgaaagtaggcaacaagtgctg
cccaggactggttttcgagcggattcctctggtcccgattacaaggagctggatgttcac
cttcggagaatggagtctggatttggcttcaggatcctgggaggagatgagcctgggcag
cctattctcatcggagcagtaattgccatgggctcagcagaccgagatggtcgtctccat
cctggggatgagctggtgtacgtagatgggatcccagtggccggcaaaacccaccgatat
gtgattgatcttatgcataacgctgcccgaaacgggcaggtgaatcttactgtgaggaga
aaggtgctacccacagagtcctccagccagaaaggtgcccccacgcccggtgcgacgccc
cctcgcagctcccccagcgcgaggaaaatggccaataaccaaggagaaccctgcccagag
aatggcagaagcccaggctcggtgtctacgcaccacagctctccaagaagtgactacacg
acctatgccaacagcaatcacgcggcctccggcagcagcgccactccccccgagggcttc
gcgtcgcacagcctgcaaaccagcgacgtggtcatccaccgcaaggagaacgaaggcttc
ggcttcgtcatcatcagctccctcaacaggcccgagtctggctccacgataactgtaccc
cataaaatagggcggataattgatggaagccctgcggatcgctgtgcaaaacttaaagtt
ggagaccggatcttagctgtgaatggccagtctattattaacatgcctcatgcagatatt
gtgaagctcattaaagatgcaggtctcagtgtaactcttcgcatcattcctcaggaggag
ctgaacagcccagcctcggcccccagctcggagaagcagagccccatggcccagcagcac
agccccatggcccagcagagtcccctggcgcagcagagccccgtcgcccagcacagcccc
gtggcccagccgccgcctccacagcccctccagccccagggacacgagaacagttacagg
tcagaagtaaaagccaggcaggatgtgaagcctgacatccggcaacccccgtttacagac
tacaggcaatcctccgcggactaccggcagcccccgctggactaccggcacccgccggtg
atggattaccagcagccaccgccgctggactacaggcagcccccgctgatggactacagg
cagcactcccctgacaccaggcagttccccctgtccgagtacaggcagccccaggacttt
gattatttcactgttgatttggagaaaggagccaaaggatttgggtttagtatccgagga
ggaagggagtacaaaatggatttgtatgtgttgaggttagcagaagatggaccagcagta
agaaatggaaggatgagggtaggagatcaaataattgaaatcaatggagaaagcacaagg
gacatgacacatgccagagcaatagagctaatcaagtctggtggcagaagagtgcgactg
ttgttgaaacgtggaacaggccaggtcccagaatatgacgagccaaactcctggagtgct
ccctctgccaccgccccaggtctgccggaagtagctctttccctcgacgacataatctca
ccattatcttcatcacacatagccccaccctctgacccttctcaccagataagcccagaa
ccaacatgggatatcaagagggaacacgatataaggaaaccaaaggagctttcggtgaac
ggtcacaaaaagaaaaggttaggagaacaaagagaaaggtcagcaagtcctaaaaaggta
gacaggtcaaagcacgaagaggcttcttggaaaggatattcaggaggcaaaagtaagacc
actgatggtggcaggcccacctcagaaagcaaagcggtgggacacagcgttatgatcgag
gctggcgcaagagagcacgtgtgtgctggaaccagtgatgaacagtttgggaggctgagg
aagccagaaagcaagagaggaggatctcttagcaaaaaagatcacagatccacaaacacc
tgtgagaagtcagctgcagcacccgaccatgtcaagaccgatacaggagctaccaagact
tacagtagcaaccgctgcagctcacctggaagtgatatggaccacagccagagggaccct
gatgggaaacccagcgagttccccaggaagggacatctccactccattagcactcgcagc
accaacaccacagttcgaaaggcaacggtctctccagggccgtggaaaatccctggctca
gataagctaccaagcgtcctgaagtctggtacttctgccatgagcagataa

DBGET integrated database retrieval system