KEGG   Pseudothermotoga lettingae: Tlet_1372
Entry
Tlet_1372         CDS       T00618                                 
Name
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
tle  Pseudothermotoga lettingae
Brite
KEGG Orthology (KO) [BR:tle00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tle02000]
    Tlet_1372
Transporters [BR:tle02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Tlet_1372
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA SMC_N Zeta_toxin SRP54 AAA_30 CLP1_P Rad17 AAA_24 AAA_22 RsgA_GTPase TsaE
Other DBs
NCBI-ProteinID: ABV33929
UniProt: A8F6Z5
Position
complement(1432960..1433718)
AA seq 252 aa
MTVIQTVDLTKRFGELKAVDTINLAVEKGEIYGFLGPNGAGKTTTIRMLTGTLKPTSGEV
KILGIDMRSNEIEIKKRIGVVPDEPKIYPNLKGYEFINFIGDIYRLDKVKMNQRVEELCE
AFSIDFLQKAVSDMSHGMKQKLYLVSVLMRKPEILFLDEPTVGLDARSAKILKMLLQKYT
SDGSTVFMTTHVLEIAEKMCTRIGIIHKGKLIVEGTLSQLREYVKSSQASLEDVFLQLTT
EGEDIASIVKEL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgactgtgatacagacagttgatttgacaaaaagattcggtgaactgaaagcggttgat
actataaatttggcagtagagaagggagaaatctatggttttcttgggccaaatggcgct
gggaaaaccacaactataagaatgctcacagggactctgaagccaacttctggcgaggta
aaaatacttggaatagatatgagatctaacgagatagagattaagaaaagaattggtgtg
gttccggatgaaccgaagatctatccaaatttgaaagggtacgaattcataaattttatt
ggagatatttaccgacttgacaaggtaaagatgaatcagcgtgtggaagagctgtgtgag
gcttttagtatagattttcttcagaaagcggtttctgatatgtctcatggcatgaagcaa
aaactttatcttgtgagtgttttgatgagaaagccagaaattctgtttcttgatgagcct
actgtcggccttgatgcaagatctgcaaaaattttgaagatgcttttacagaaatataca
tctgatggaagcactgttttcatgacaacacatgtactggagatagcagaaaagatgtgt
acaagaattgggataatacacaaaggtaagcttatagttgaaggaacgctttctcaactt
cgcgaatatgttaaaagttcccaggcttctcttgaagatgttttcttgcagttaacgact
gaaggtgaagatatagcttcgattgtgaaggagttgtga

DBGET integrated database retrieval system