KEGG   Thermotoga maritima MSB8: TM0463
Entry
TM0463            CDS       T00022                                 

Definition
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma03060  Protein export
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM0463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tma01002]
    TM0463
Enzymes [BR:tma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     TM0463
Peptidases and inhibitors [BR:tma01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   TM0463
SSDB
Motif
Pfam: Peptidase_A8 TMEM238 LIDHydrolase
Other DBs
NCBI-ProteinID: AAD35555
UniProt: Q9WYT4
Position
complement(492551..493111)
AA seq 186 aa
MAFVMVLTIVLDQLTKRIASEIHGTFFIVPGFLRFVKATNRGIALGLFKNLSEQLLWTVM
FVVVFLSLLPYIFKFSRLERIAMGFILGGALGNLLDRIRFGYVLDFLNLTFLPTIFNLAD
VFIIVGGALMILGVFRGGDNESLESRKKRRGLETGSVFEGEDTIMDLEINDSKSDKRGQS
EGQRSD
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcgtttgtgatggttctcacaattgttctggatcagcttacaaagcggatagcaagc
gagatacacggaacttttttcatagttccgggttttttgagattcgtgaaggcaaccaac
cgaggaatcgcactcgggttgtttaaaaatctttccgaacagcttctctggaccgtgatg
ttcgttgttgtttttctctccctgcttccttatattttcaagttcagcaggctggaaaga
atagccatgggcttcattcttgggggagctctcggcaaccttctcgacagaatcagattc
ggatacgttcttgattttctgaacttgacctttctcccaacgatattcaacctagcggat
gtgttcatcatagtcggaggagcgcttatgatactgggagttttcagaggtggagacaat
gaaagtttggagagtcgaaaaaagagaagagggctggagactggatcagtttttgaagga
gaagacaccatcatggatctcgagatcaatgattcaaaaagcgataaaagagggcaaagt
gaaggtcaacggtcagattaa

DBGET integrated database retrieval system