KEGG   Thermotoga maritima MSB8: TM0570
Entry
TM0570            CDS       T00022                                 

Definition
(GenBank) cell division protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM0570
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM0570
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM0570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM0570
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM0570
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_30 AAA_22 CbiA AAA Zeta_toxin Thymidylate_kin AAA_17 AAA_18 AAA_24 AAA_19 AAA_33 DUF2075 ATP_bind_1 AAA_16 ATPase MMR_HSR1 Helicase_RecD cobW MipZ AAA_31 AAA_28 KTI12 MeaB APS_kinase PIF1 PRK ABC_tran MobB Viral_helicase1 ADK
Other DBs
NCBI-ProteinID: AAD35655
UniProt: Q9WZ40
Structure
PDB: 
1VMA

Position
complement(599293..600177)
AA seq 294 aa
MGLFDFLKKGLQKTKETFFGRVVKLLKGKKLDDETREELEELLIQADVGVETTEYILERL
EEKDGDALESLKEIILEILNFDTKLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEG
KSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVAFDAVAHALARNKDVVII
DTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVT
GIILTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
NT seq 885 nt   +upstreamnt  +downstreamnt
atgggactcttcgattttttgaaaaagggactccagaagacgaaagaaacgttttttgga
cgagtggtgaagctcctcaaaggaaaaaagctggacgatgaaacccgcgaggagctggaa
gaacttctcattcaagcggacgtgggagtcgagacaacggaatacattctggagagattg
gaagagaaggacggagacgctctcgagtctctcaaggaaatcattctggaaattctgaac
ttcgatacgaagctgaacgttcctcctgaacccccgttcgtgatcatggttgttggtgtc
aacggaacgggaaagaccacctcctgtggaaagctcgcaaagatgttcgtggatgaagga
aagagtgtggtgctcgctgcggcggatactttcagagcagccgccatagaacagctgaag
atatggggagaacgtgtcggtgccacggtgatatcccactcggaaggagcagatccggcc
gccgttgcctttgacgcggtggctcacgctctcgccagaaacaaagatgtggtcataata
gacaccgccggaagacttcacacgaagaagaatctcatggaggaattgcggaaggttcac
agagttgtcaagaagaagatccccgacgctccgcacgaaacgctcctcgtgatagacgcc
accaccggccaaaacggacttgttcaggcaaaaatattcaaagaagcagtgaatgtcacc
ggtataattctcacaaagctcgacggaaccgcgaaaggcggaataactctggccattgcc
cgggaactgggaattcccataaagttcatcggtgtcggagaaaaggcagaagacctgagg
cctttcgatcctgaggcctttgtggaggtattgctttcagaatga

DBGET integrated database retrieval system