KEGG   Thermotoga maritima MSB8: TM1064
Entry
TM1064            CDS       T00022                                 
Name
(GenBank) oligopeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tma00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM1064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tma02000]
    TM1064
Transporters [BR:tma02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    TM1064
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 TniB AAA_22 ATP-synt_ab AAA_16 AAA DUF87 ABC_ATPase PRK RNA_helicase NACHT NB-ARC
Other DBs
NCBI-ProteinID: AAD36139
UniProt: Q9X0F4
Position
complement(1078293..1079291)
AA seq 332 aa
MSTLLQIKNLRTYFFTDEGVVKAVDGVSFEIEEGRTLGVVGESGCGKSVTARSIIKLLST
AGRIVSGEILYNMDGQMVDLVKFSKEEIRKVRGRHIAMIFQEPMAAFSPVYTIGDQITEG
MIYHFGITKQEARERAVELLRRVGIPKPEKMIDSYPFEYSGGMRQRAMIAMALSCNPRLL
IADEPTTALDVTIQAQVLDLLKDLQQEYKMAIMMITHNMGVVAEMADHVVVMYLGRVVES
APVEELFYNPKHPYTSLLLRSIPVVGKRVERLEVIEGDVPDPRNMPKGCRFHPRCPYMMK
GICDEREPVEVEVGPEHRVSCFLYGGEKDGAS
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagtacattgcttcagataaaaaatttgagaacgtacttttttacagacgaaggtgtt
gtgaaggcagtggatggtgtgagttttgagatagaggaaggaaggacattgggtgttgtg
ggagagagtggttgtggaaagagcgtcacggcaagatccatcatcaagcttttgagtaca
gcaggtcggatcgtctcgggggagatcctctacaacatggacggtcagatggtggacctt
gtgaagttctcaaaggaagagatcagaaaggtcagaggaaggcacattgcgatgatcttt
caggagcccatggctgccttttctcctgtgtacacgattggagatcagatcacggagggt
atgatctaccactttggaatcacaaagcaggaggcaagagagcgcgcggtagaacttctg
agaagagttggtattccaaagccggagaagatgatagattcttatccgtttgagtactcg
ggtggtatgaggcagcgtgcgatgatagcgatggctctttcgtgtaatcctcgtcttctg
atagcggatgagccgacaactgctctggatgtgacgattcaggcacaggttctcgatctt
ttgaaggacctgcaacaggagtacaaaatggcgatcatgatgatcacgcacaatatgggt
gttgtggcggagatggcggatcatgtggtggtgatgtaccttgggagggtggtagagagc
gctccggttgaagaactcttctacaatcccaaacatccgtacacatcgcttcttttgagg
tccattccggttgtgggaaagagggtagaaaggcttgaggtgatagagggagacgtacca
gatccaaggaacatgccgaagggttgccggtttcatccgaggtgtccttacatgatgaag
ggaatctgcgatgagagggagccggtcgaggttgaggtggggccagaacacagagtcagt
tgttttctctatggaggggaaaaagatggcgcttcttga

DBGET integrated database retrieval system