KEGG   Thermotoga maritima MSB8: TM1578
Entry
TM1578            CDS       T00022                                 

Definition
(GenBank) preprotein translocase SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02024  Quorum sensing
tma03060  Protein export
tma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    TM1578
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TM1578
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TM1578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tma02044]
    TM1578
Enzymes [BR:tma01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     TM1578
Secretion system [BR:tma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   TM1578
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind Helicase_C DUF6429 MEDS
Other DBs
NCBI-ProteinID: AAD36645
UniProt: Q9X1R4
Structure
PDB: 
4YS0 3JUX 3DIN

Position
1565830..1568445
AA seq 871 aa
MILFDKNKRILKKYAKMVSKINQIESDLRSKKNSELIRLSMVLKEKVNSFEDADEHLFEA
FALVREAARRTLGMRPFDVQVMGGIALHEGKVAEMKTGEGKTLAATMPIYLNALIGKGVH
LVTVNDYLARRDALWMGPVYLFLGLRVGVINSLGKSYEVVWKNPDLARKAIEENWSVWPD
GFNGEVLKEESMNKEAVEAFQVELKEITRKEAYLCDVTYGTNNEFGFDYLRDNLVLDYND
KVQRGHFYAIVDEADSVLIDEARTPLIISGPSKESPSVYRRFAQIAKKFVKDKDFTVDEK
ARTIILTEEGVAKAEKIIGVENLYDPGNVSLLYHLINALKALHLFKKDVDYVVMNGEVII
VDEFTGRLLPGRRYSGGLHQAIEAKEGVPIKEESITYATITFQNYFRMYEKLAGMTGTAK
TEESEFVQVYGMEVVVIPTHKPMIRKDHDDLVFRTQKEKYEKIVEEIEKRYKKGQPVLVG
TTSIEKSELLSSMLKKKGIPHQVLNAKYHEKEAEIVAKAGQKGMVTIATNMAGRGTDIKL
GPGVAELGGLCIIGTERHESRRIDNQLRGRAGRQGDPGESIFFLSLEDDLLRIFGSEQIG
KVMNILKIEEGQPIQHPMLSKLIENIQKKVEGINFSIRKTLMEMDDVLDKQRRAVYSLRD
QILLEKDYDEYLKDIFEDVVSTRVEEFCSGKNWDIESLKNSLSFFPAGLFDLDEKQFSSS
EELHDYLFNRLWEEYQRKKQEIGEDYRKVIRFLMLRIIDDHWRRYLEEVEHVKEAVQLRS
YGQKDPIVEFKKETYYMFDEMMRRINDTIANYVLRVVKVSEKDEKEAKEELGKIRLVHEE
FNLVNRAMRRATEKKKKKDGLHSFGRIRVKR
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgatactcttcgataagaacaagcgcattttgaaaaaatacgcgaagatggtctcaaaa
ataaaccaaatagagtccgatctacgctcgaagaaaaacagcgagctgataagactttcc
atggtgctgaaggaaaaagtgaattcctttgaggacgccgatgaacacctttttgaagcg
ttcgccctggttagagaagcagcacgaagaacgctcggaatgaggcctttcgatgtccag
gtgatgggtggtatagcgctccatgaaggaaaagtggccgagatgaagaccggtgaagga
aaaaccctcgccgccaccatgccgatttatctgaacgctctcatcggaaagggtgttcat
ctggtcacggtcaacgactatctggccagaagagatgcgctctggatgggacccgtgtat
ctctttctcggtttgagagtgggtgtgataaattctctgggaaagtcgtacgaggtggtg
tggaaaaaccctgatctcgccagaaaagcaatagaggaaaactggagtgtctggcctgat
gggttcaacggagaagttttgaaagaggaatctatgaacaaagaagccgttgaggctttc
caggtggaactcaaagagataaccaggaaggaagcctatctgtgtgacgttacctacggc
acgaacaacgaattcggcttcgattacctgagggataacctcgttctcgattacaacgat
aaggtgcagagaggccacttctacgccattgtggacgaagccgacagcgtactcatagac
gaagcaaggaccccactgatcatctccggtccctccaaagagagtccttctgtgtacagg
agattcgctcagatcgctaagaagtttgttaaagataaggacttcacggtagatgaaaaa
gcgaggaccatcattctcaccgaagagggtgtggcgaaagcggagaagatcatcggtgtc
gaaaacctttacgatccgggaaacgtgtctcttctctaccatctcataaatgccttgaaa
gcgctgcacctgttcaagaaggatgtcgattacgtcgtcatgaacggtgaagttattatc
gttgacgagttcacgggaagactgctgcctggcagacgctacagtggagggctccaccag
gctatcgaagccaaagaaggagtacccataaaggaagaatccatcacctacgcgacgatt
acctttcagaattacttcagaatgtacgaaaagctcgccggtatgacgggaacagccaaa
acagaggaaagcgaattcgtacaggtttacggtatggaagtggtggttattcccactcac
aagcccatgataagaaaggaccacgatgatctggtcttcaggactcagaaagaaaagtac
gaaaagatcgtggaagaaatcgaaaagcgctataaaaaaggtcagccagttcttgtcgga
acaacctccatcgaaaagagcgaacttctcagttccatgctgaaaaagaaaggtatcccc
catcaagttttgaacgcgaaataccatgaaaaagaagctgagatcgtcgccaaagccggg
caaaaaggcatggtgacgatcgccaccaacatggctgggagaggaacagatataaaactc
ggaccaggagtggcggaacttggaggactgtgcatcataggaacggaaagacacgagagc
agaagaatcgataatcagctgagaggacgtgccggtaggcaaggagatccgggagagtcc
atcttcttcctctctctcgaagacgatcttctgagaatcttcggtagtgaacagattgga
aaagtgatgaacatactcaaaatagaggaaggacagcctatacagcatccgatgctttca
aagctcatcgaaaacattcagaagaaggttgagggtatcaacttctcgataagaaaaacc
ttgatggaaatggatgatgtcctcgacaaacaaagaagagcagtgtactcgcttcgcgat
cagatccttctcgaaaaagactacgacgaatatctgaaggatatcttcgaagatgttgtc
agcacaagggttgaggagttctgttccgggaaaaattgggatatcgaaagcctcaagaat
tctctttctttcttcccggctggtttgttcgacctggacgaaaagcaattcagttcttct
gaagaacttcacgattacctgttcaacagactttgggaggaatatcagagaaagaagcag
gaaataggcgaggattacaggaaagtgatcagattcctgatgctcagaataatagacgat
cactggagaagatacctggaagaggtagagcacgttaaggaagccgttcagctgaggtct
tacggtcagaaagatcctatcgttgaattcaaaaaggaaacgtactacatgttcgatgaa
atgatgaggagaataaacgatacgatagccaactacgtcctcagagttgttaaagtctcg
gaaaaggatgaaaaagaggccaaagaagaacttggtaaaataagactcgtgcatgaagaa
ttcaatcttgtgaacagagcgatgagaagagccacagaaaagaaaaagaaaaaagatgga
ctgcacagctttggtagaataagagtgaagaggtga

DBGET integrated database retrieval system