KEGG   Phaeoacremonium minimum: UCRPA7_4641
Entry
UCRPA7_4641       CDS       T03102                                 

Definition
(RefSeq) putative nitrite reductase protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00910  Nitrogen metabolism
tmn01100  Metabolic pathways
Module
tmn_M00531  Assimilatory nitrate reduction, nitrate => ammonia
tmn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    UCRPA7_4641
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     UCRPA7_4641
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Amino_oxidase Pyr_redox_3 K_oxygenase
Other DBs
NCBI-GeneID: 19325112
NCBI-ProteinID: XP_007915383
UniProt: R8BK97
Position
Unknown
AA seq 1104 aa
MAAGHRKKLVVVGLGMVGISFIEKLLKLDARAREWDIVVIGEEAHLAYNRVGLTSFFEHR
KVENLYLNPLEWYEGILDNALGWHLNKKVTEIHPDRKIVTCADGTEVSYDTLVLATGSDA
VLPRHTPGHDANGVFVYRNIEDLERLIAFSATKKDTYGAVVGGGLLGLEAAKAMMDLETF
KQVKVIERNRWVLSRQLDSDAGAMVVEQVRALGVDVMLSRRVGKIDTDGNNNVVGVHFED
GEYMPCSTVCFAIGVRPRDELARSAGIRCADRGGGIVVNDDLSTSEPHIYAIGECASWQS
QTFGLIAPGVEMADVLSFNLTQAKLHQPRLYKRPDLSTKLKLLGVEVASFGDFFADRDGP
KYLPARAARKKKAEDKAHDVKILTNGLPPPDVKALTYKDPFQNVYKKYIFTTDGKYLLGG
MMIGDTKDYVKLVPLVKQQKELDIPPSELILGAKKDGDDDGDDLEDDTQICSCHNVTKGD
VVNVVKDGTCKSLGDIKSCTKAGTGCGGCMPLVTSIFNKTMISMGNEVKNNLCPHFNYSR
ADLYNIVFVKRLRTLPEVMREAGVDPDSLGCEVCKPAVASIFASLWNKHVMDKTHHGLQD
TNDRFLGNIQRNGTFSVVPRVSGGEITPDKMIVMGQVAKQYGLYTKITGGQRIDMFGAKK
QDLLEIWKTLVDAGMESGHAYAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEERYKSIRS
PHKIKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSEILAKDVPPAEVI
PILDRYLMFYIRTADKLQRTARWLEGLPGGIKYLQEVILEDKLGINASLEAQMKELVDSY
FDEWAEAIKNPAIAAKFKQFNNTEETVETVEVEKDRDQPRPVFWAKESAKEDFQGLRSKW
SFTTWQPVIEASHFAGADSSPNGVSATIKRGDTQLALWRVRGRYFATQQMCPHKRAFVLS
DGLIGEDTPATDEKGESKGDASDKVKPGAPWVSCPYHKRNYDLSSGSCKNDSELSIATFE
AEERADGFVYIKLPPVEELDAELGTKKWMVKKGETKSQFEELDRKIKFIGQRAKKPGVKP
HVELPMRKPVELMAGGGCGAAPDW
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcggctggtcacagaaagaagctcgtggtggtcggcttgggaatggtgggaatcagc
ttcatagagaagttgctcaagctcgacgcccgagctagagaatgggatattgttgtcatc
ggcgaggaggcgcacctggcctacaaccgcgttggcctgacgagcttcttcgagcacagg
aaagtcgagaacctgtacctgaatcccctggaatggtatgagggtattctggacaacgcc
ctcggttggcacctgaacaagaaggtcaccgagatccatccggatcgaaagattgtcaca
tgtgcggacggcactgaggtctcgtatgacaccttggtgctggccacgggctcagacgcc
gtgctaccccggcacactccaggccatgatgccaacggagtgttcgtctaccggaacatc
gaggatctggagcggctaatcgccttctctgccacgaagaaagacacctacggggcggtt
gtgggcggtggtctcctcggcttggaggcggccaaggcgatgatggacctcgaaacattc
aagcaggtcaaagtcattgagcgcaatcgctgggtgctcagcaggcagctggacagcgac
gcgggcgccatggtggttgagcaggtgcgcgcgctcggtgtcgatgtgatgctcagcagg
cgggtgggaaagatcgacacggacggcaacaacaacgtcgtaggcgtgcacttcgaggat
ggcgagtacatgccctgctcgacggtctgcttcgccatcggcgtgcggccgcgcgacgag
cttgcaagatcggcgggcattcgatgtgcagaccgaggcggtggcattgttgtcaatgat
gatctgagcacgagcgagccgcacatctacgccattggagagtgtgcgagctggcagagt
cagacgtttgggctgattgcgccgggcgtggagatggctgatgtcttgtcattcaatctt
actcaagcgaaacttcaccaacctcggctttataagaggccggatctgagtacgaaacta
aagttgctgggcgttgaagttgccagctttggagacttcttcgctgatcgtgatgggcct
aaatacctgccggctcgagcagcgaggaagaagaaagcggaagacaaagcgcacgatgtg
aaaatactgacgaatggccttccgccgccggatgtcaaggctttgacgtacaaggacccc
ttccaaaatgtgtacaaaaagtacatcttcaccacggatggcaagtatctactgggtggg
atgatgattggtgacacaaaggactacgtgaagctagtgccgcttgttaagcagcagaag
gagcttgacattccgccgagcgagcttatcctcggcgcgaagaaggacggagacgacgat
ggtgatgatttggaagatgacactcagatatgctcgtgtcacaatgtgacaaagggcgac
gtcgtcaacgtcgtcaaagacggcacgtgtaagtctctcggcgatatcaagtcgtgcacg
aaggccggtacggggtgcggcggatgcatgccgctagtgacctccatcttcaacaagacg
atgatatcgatgggcaacgaggtcaagaataatctatgcccgcacttcaactacagccga
gcagacctctacaatatcgttttcgtcaagcgcctacgcaccttgcccgaagtaatgcgc
gaggcgggcgtcgacccagatagcttaggttgtgaggtgtgcaagccggctgtggcaagc
atttttgcgagcttgtggaataaacatgttatggataagacgcaccacggcctgcaagac
acgaacgatcgcttcttgggcaatatccagcgcaatggcacgtttagtgttgtcccgcga
gtttcgggcggcgagatcacgccggacaagatgattgtcatgggccaggttgccaagcag
tatggcctatacaccaagatcactggtggccagcgtatcgacatgtttggtgctaagaag
caggacttgctggagatctggaagacgcttgtcgatgctggaatggagagcggtcatgcg
tatgccaagtcactacgtacggttaagagctgtgtgggcacgacgtggtgccgttttggt
atcggtgacagcgtgggcatggctgtacgtctggaggagcggtacaagagcattcgaagt
ccgcacaagatcaagggtggtgttagcggttgtgtgcgtgagtgtgctgaggcgcaaaac
aaagattttggcctaatagcaaccgagaaaggtttcaacatattcgtcggcggcaatgga
ggtgccaagcccagacattcggaaattttggccaaggacgttcctccggctgaggtgatt
cccatattggaccgatatctgatgttctacattcgcacagcagacaagctacagcggaca
gcgcgctggcttgagggcctgccgggtggcatcaaatatctacaagaggtaattctcgaa
gacaagctaggcatcaacgcctcactggaggcacagatgaaggagctcgtggacagctac
tttgatgagtgggccgaagccatcaagaacccggccatagctgccaagttcaagcaattc
aacaacacagaggaaaccgttgagacagtggaggtagaaaaagaccgcgaccaaccccgc
cctgtgttctgggcaaaggaatctgccaaggaggatttccagggcctgcgcagcaagtgg
tcattcaccacatggcaacctgttatcgaagcgagtcacttcgcaggagcggactcttct
ccgaatggcgtgagtgccacgatcaaacggggtgacacgcagttggcgttatggcgcgtc
cgcgggcgttactttgccacacagcaaatgtgtccacacaagcgagcctttgtgctgtcg
gacggtctcataggagaagacacgccagccacagatgagaagggcgaatccaagggcgac
gcttccgacaaggtcaagccgggtgcgccgtgggtatcgtgtccgtatcacaagcgcaac
tatgacctatcaagcggtagctgcaagaacgactcggagttgagcattgcgaccttcgag
gccgaggagagggcagacggttttgtgtatatcaagctgccgcccgtcgaagaattggac
gctgagctaggcaccaagaagtggatggtcaagaaaggggagactaagagccagtttgag
gagctcgaccgcaagatcaagttcatcgggcagcgggcaaagaagcccggcgtaaaaccc
catgtcgaactgccgatgcgcaagccggttgagcttatggctggtggtggatgtggagcc
gcgccggactggtaa

DBGET integrated database retrieval system