KEGG   Thermotoga petrophila: Tpet_1013
Entry
Tpet_1013         CDS       T00525                                 

Definition
(GenBank) ribosome small subunit-dependent GTPase A
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00730  Thiamine metabolism
tpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Tpet_1013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tpt03009]
    Tpet_1013
Enzymes [BR:tpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     Tpet_1013
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Tpet_1013
Ribosome biogenesis [BR:tpt03009]
 Prokaryotic type
  GTPases
   Tpet_1013
SSDB
Motif
Pfam: RsgA_GTPase RsgA_N MMR_HSR1 eIF-1a FeoB_N GTP_EFTU MMR_HSR1_Xtn Arf AAA_16 Ras PduV-EutP ATP_bind_1 cobW ABC_tran Prok_Ub NatB_MDM20 AAA_29 MnmE_helical
Other DBs
NCBI-ProteinID: ABQ47031
UniProt: A5ILF8
Position
1041499..1042386
AA seq 295 aa
MSLRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGV
IENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVFNKMD
LYDEADLKKVRELEEIYSELYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLL
NAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEISDIEPEELKN
YFKEFGDKQCFFSDCNHVDEPDCGVKEAVENGEIAESRYENYVKMFYELLGRRKK
NT seq 888 nt   +upstreamnt  +downstreamnt
atgagtttgagaagaagaggaatagtggtgagttttcactcgaacatggtaacggttgaa
gacgaggaaaccggtgaaagaatcctctgcaaactgagaggaaaattccgtctgcagaac
ctcaagatatacgttggagacagggtggagtacacaccggatgaaacaggatccggagtc
atagagaacgtgctgcacagaaaaaatctgctcaccaaacctcacgttgcaaatgtggac
caggtgatccttgtggtgacagtgaaaatgccggaaacttcgacctacataatcgataaa
tttcttgttctcgccgaaaaaaacgaactggaaacggtgatggtcttcaacaagatggac
ctctacgacgaggccgacctgaagaaagtgagagaactggaagagatctattctgaactc
tatccaatcgttaaaaccagtgcgaaaactggaatggggattgaggagctcaaggaatat
ctgaagggaaagatcagcacaatggccggactctccggagttggaaaaagtagcttgctc
aacgccataaatccgggcttgaagcttcgcgtgagcgaagtttcagagaaactccagaga
ggaagacataccacaacaactgcccagctcttgaaattcgatttcggtggttatgtggtc
gatactccgggcttcgcaaatctggagatcagcgacatagaacccgaggaactgaaaaac
tacttcaaggaatttggagacaaacagtgtttcttctcagattgcaaccacgtggatgaa
ccggattgtggagtgaaagaagccgtggagaacggagaaatcgcagagagtcgatacgag
aattacgtgaagatgttttacgagcttctgggaaggaggaaaaagtaa

DBGET integrated database retrieval system