KEGG   Takifugu rubripes (torafugu): 101071121Help
Entry
101071121         CDS       T02386                                 

Gene name
erp44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tru04131]
    101071121 (erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101071121 (erp44)
Membrane trafficking [BR:tru04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101071121 (erp44)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101071121 (erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 HyaE Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 101071121
NCBI-ProteinID: XP_011603971
Ensembl: ENSTRUG00000010972
UniProt: H2TSN9
Position
7
AA seq 408 aa AA seqDB search
MKLLAISVFLDIRFISVLLLVMGLSSPGKAEIVHLDSGNIDEVLNNAGVALVNFYADWCR
FSQMLHPIFEEASNIVREEFPSTHQVVFARVDCDQHSDIAQRYRINKYPTLKLFRNGMMM
KREYRGQRSVVAIADFIRQQQVDPVKELLTMEEANTVDRSKRNIIGYFETKDSDNYHAYE
KVANILRDDCTFSAAFGPASESERVGGDNMIYKPVGENVPDMVYLGSLASFDLAYAWAQD
KCVPLVREITFENGEELTEEGLPFLILFHINDDTESLEKFQQEVARQLISEKGTINFLHA
DCEKFRHPLLHIQKSPTDCPVIAIDSFRHMYVFPDFKDLNIPGKLKQFVLDLHSGKLHRE
FHHGPDPTNSTPGQEENEVASSPPKSSFQKLAPSETRYTILSRDRDEL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattagcaatatcagtctttcttgatatccgcttcatctcggttttactactg
gtgatgggcctgtcgtctcctggaaaggcagagattgtacatttggactcgggcaacatt
gatgaggtcctaaataatgctggcgtggcgttggtgaacttttacgcagactggtgcagg
ttcagtcagatgcttcatccaatttttgaggaggcatcaaacatagtgagggaggagttc
cccagcacccatcaggtggtgttcgcccgcgtcgactgcgaccagcactcggacatagcc
cagcggtaccgcatcaataagtaccccacgctgaagttgtttcgcaatgggatgatgatg
aagcgggagtacaggggtcagaggtcagtggtcgccatcgccgacttcatccgccagcag
caggtcgaccccgtgaaggagctgctgacgatggaagaggccaataccgtggacaggagt
aagagaaatatcatcggctacttcgagaccaaggactctgacaactaccacgcgtatgaa
aaggttgccaacatccttcgagatgactgcactttctccgctgcctttgggcccgcgtct
gagtccgagcgtgtcgggggggacaacatgatctacaaacctgtgggggagaacgttcct
gacatggtctacctcggctcgctcgccagcttcgacctggcctacgcctgggcccaggac
aagtgtgtgcctctggtcagagagatcaccttcgaaaacggagaggaactgaccgaagaa
ggactgcctttccttatcttgttccacatcaatgacgacacagagagtttagagaagttc
cagcaggaagtggcgcgccagctcattagcgaaaaaggcacaataaacttcctgcacgca
gactgtgagaagttccgtcatcctttgctccacatccagaaatctcccaccgactgtccc
gtcatcgccatcgactcattccgacacatgtacgtctttccagacttcaaagatctgaat
atccctggaaagttgaagcagtttgtcctggaccttcattctggaaagctgcacagggag
ttccaccatggacccgatcccacgaacagcacacctggacaggaggagaacgaagtggcc
agcagccccccaaagagctcgttccagaagctggcgcccagcgagacccgctacacaatc
ctcagtcgagaccgcgatgaactgtga

DBGET integrated database retrieval system