KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0958Help
Entry
Tsac_0958         CDS       T02137                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00790  Folate biosynthesis
tsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tsac_0958
Enzymes [BR:tsh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Tsac_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFK85974
UniProt: I3VTX9
Position
1003256..1004068
Genome map
AA seq 270 aa AA seqDB search
MAYMLKLRDKELEIGKRTYIMGILNMTPDSFSDGGKYNTLEKGMERALKMMEDGADIIDV
GGESSRPGYEPVTAEEELSRINDIVKKLCEVDTIISIDTMKSKVAYECLKNGAHIINDIW
GLQRDPDMAKVVADYGAGVVIMHNKEVAEYHDLLQEVISFFEKSIDIALKAGIKKENIMI
DPGIGFGKTLEHNLTLMKRLDELKILGLPILLGTSRKSMIGRVLNLDVNERMEGTAATVA
VGIVKGADIVRVHDVKEMWRVARMTDAMIR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcttatatgttaaaattaagagataaagagttggaaattggaaagagaacgtacata
atgggcatattgaatatgacgcctgattctttctctgatggtggaaaatacaatactttg
gagaagggcatggaaagagccttaaagatgatggaagacggagctgatataatagacgta
ggcggcgaatcttcaaggcctggatacgaacctgtgactgcagaagaagaactttccagg
ataaatgatatagtcaagaagttgtgtgaagtagacaccataatttcaattgatacaatg
aagtcaaaagtggcctacgagtgccttaaaaatggagctcacatcataaacgacatctgg
ggtttgcaaagagatcctgatatggcaaaagtcgttgctgattatggtgctggcgtggtg
ataatgcacaataaggaagtggcagaataccatgaccttttgcaggaggttataagtttc
tttgagaaaagcattgatattgctttaaaagcaggcataaaaaaggaaaacataatgatc
gatcccggaataggttttgggaagactttagagcacaatctgacattgatgaaaaggctt
gatgagcttaaaatattgggacttcctatattgcttggcacatcaagaaaatcaatgata
gggcgtgtcttaaaccttgacgtaaatgaaagaatggagggtactgctgccacagttgcg
gttggaatagtaaagggtgctgacatcgtcagagtgcacgacgtgaaagaaatgtggcga
gtagccaggatgacggatgcgatgataagatga

DBGET integrated database retrieval system