KEGG   Thermus thermophilus HB8: TTHA0889
Entry
TTHA0889          CDS       T00220                                 
Symbol
TTHA0889
Name
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:5.6.2.4]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    TTHA0889 (TTHA0889)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ttj03400]
    TTHA0889 (TTHA0889)
Enzymes [BR:ttj01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     TTHA0889 (TTHA0889)
DNA repair and recombination proteins [BR:ttj03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      TTHA0889 (TTHA0889)
SSDB
Motif
Pfam: CarD_CdnL_TRCF TRCF DEAD Helicase_C ResIII UvrB_inter AAA_16
Other DBs
NCBI-ProteinID: BAD70712
UniProt: Q5SJW3
Position
1:845828..848764
AA seq 978 aa
MEIALERIYGHRLALPQVGAALLFAQEAPPALLLVPEARLRRYRDLSAFGAKVYVNPGLE
ALEEKALFVLSYEEALSPFPEDPEAWRLLLEVGRAYPREALLSRLLKLGYARDEDYRVLG
EVVELGEVRLEFFGDELERLVVRGEERRRHVLLPKPGKAEGFTSKKVLHFPGPVYLDTPA
LAPKALWPLLAGRPWVALGGGVELPPLELGARPLPPYRGSLKALEKDLARWLAEGKRVHL
FVGHARTLEYLKRRLQAFSPLILDRFPGPKGRLALLPGDFEGGAEWGEWVLLTEALVFAT
GGVRARVRVGEGLSDPGALSPGDYLIHPEHGVGQYLGLETREVLGVKRDYLVLRYKGEGK
LYLPVEQLPLLKRHPGTTDDPPELSSLGKNEWQRAKERARKDVEELAGRLLVLQAKRKAT
PGRAFPPLPEWDPLVEKGFPYELTPDQKRALEEVLRDLESPHPMDRLVSGDVGFGKTEVA
LRAAHRVVGHGAQVAFLVPTTLLAEQHGKTFRERFQGLPVRVAVLSRFTPPKEEEAILKG
LAEGTVDIVIGTHRLLQEDVRFRDLGLLIVDEEHRFGVAQKERIRELKAEVDTLYLSATP
IPRTLYSALVGLKDLSSIQTPPPGRKPIKTFLAPFDPLLVREAILFELERGGKVFYVHDR
VASIEARRRFLENLVPEARIGVVHGQMPESLIEETMLLFAEGAYDVLLATTIIEAGLDVP
EANTILIERADRLGLATLYQLRGRVGRREEEAYAYLFHPPRLTEAAEKRLAAIADLSDLG
SGHLLAERDMEIRGVGNLLGPEQHGHIRALSLEVYTELLEEAIRKLKGEAKEERRHVTLD
LALSARLPAEYVGSLEARSRYYSRFAEAKSLAELSRLVRELKERYGPLPEEAENFVALAR
LRLVAERKGVVSITEGLTHLEVVFPRYPLDYDARGLKGLPYRVELTQYPPGFRLEKKGLR
PRDYPEALMEVLYLFADL
NT seq 2937 nt   +upstreamnt  +downstreamnt
atggaaatcgcgctagagaggatctacggccaccgcctggcgctcccgcaggtgggggcg
gccttgcttttcgcccaggaggcccccccggccctcctcctcgtccccgaggcgcggctt
aggcgctaccgggacctctccgccttcggggccaaggtctacgtgaaccccggcctcgag
gccctggaggaaaaagccctcttcgtcctctcctacgaggaggccctaagccccttcccc
gaggaccctgaggcctggcggcttcttctggaggtgggccgcgcctacccccgggaggcc
ctcctctcccgcctcctcaagctgggctacgcccgggacgaggactaccgcgtcctgggg
gaggtggtggagctcggcgaggtgcgcctggagttcttcggggacgagctggaaaggctt
gtggtccggggggaggaaaggcggcgccacgtccttctgcccaagccggggaaggcggag
ggcttcacctccaagaaggtcctccacttccctggccccgtctacctggacacccccgcc
ctcgcccccaaggccctttggcccctcctcgcgggaaggccctgggtggccctgggcggc
ggggtggagctcccccccttggagctcggggcgaggccccttcctccttaccggggaagc
ctgaaggccctggaaaaggacctcgcccgctggcttgccgaggggaagcgggtccacctc
ttcgtgggccacgcccgcaccttggagtacctcaaaaggcgcctccaggccttctcgccc
ctcatcctggaccgcttccccggccccaaggggcggcttgccctcctccccggggacttt
gagggcggggcggagtggggagagtgggtcctcctcaccgaggccctggtcttcgccacc
gggggggtgcgggccagggtccgggtaggggaggggctcagcgaccccggggccctttcc
ccaggggactacctcatccacccggagcacggcgtcgggcagtacctgggcctcgagacc
cgggaggtcctgggggtcaagcgggactacctggtcctgcgctacaagggggaagggaag
ctctacctccccgtggagcagcttcccctcctcaagcgccaccccgggaccaccgacgac
cccccggagctttcctccctgggcaagaacgagtggcaaagggccaaggagcgggcgcgg
aaggacgtggaggagctggctgggcgcctcctcgtcctccaggccaagcgcaaggccacc
ccgggccgggcctttccccctttgcccgagtgggatcctctggtggagaaggggttcccc
tacgagctcacccccgaccagaagcgggccctggaggaggtcctccgcgacctggaaagc
ccccaccccatggaccgcctggtctcgggggacgtgggcttcggcaagacggaggtggcc
ctgagggccgcccaccgggtggtggggcacggggcccaggtggccttcctcgtgcccacc
accctcctcgccgagcagcacgggaagacctttagggagcgcttccaggggcttcccgtg
agggttgcggtcctctcccgcttcaccccgcccaaggaggaggaggccatcctaaaaggc
ctcgccgaggggacggtggacatcgtcatcggcacccaccgcctcctccaggaggacgtg
cgcttcagggacctcggcctcctcatcgtggacgaggagcaccgcttcggcgtggcccaa
aaggagaggatccgggagctcaaggcggaggtggacaccctctacctctccgccaccccc
atcccccgcaccctctactccgccctggtgggcctcaaagacctttccagcatccagacc
ccgcccccggggcgcaagcccatcaagaccttcctcgctccctttgatcccctcttggtg
cgggaggccatcctctttgagctggagcgtgggggcaaggtcttctacgtccacgaccgg
gtggcctccatagaggccaggcggcgctttctggaaaacctcgtccccgaggcccgcatc
ggggtggtccacggccagatgcccgaaagcctcattgaggagaccatgctcctcttcgcc
gaaggggcgtacgacgtcctcctcgccaccaccatcattgaggcgggcctggacgtgccc
gaggcgaacaccatcctcattgagcgggcggaccgcctgggcctcgccaccttgtaccag
ctccggggccgggtggggcggagggaggaggaggcctacgcctacctcttccacccgcct
cgcctcaccgaggccgcggagaagcgcctcgccgccatcgccgacctctccgatctgggc
tcgggccacctcctggccgaaagggacatggaaatccggggcgtggggaaccttttgggg
ccggagcagcacgggcacatccgggcgctttccctcgaggtctacaccgagcttctggaa
gaggccatccgcaagctcaagggggaggccaaggaggagcggcggcacgtgaccctggac
ctcgccctctccgcccggctgcccgcggagtacgtggggagcctcgaggccaggagccgc
tactacagccgttttgccgaggcgaaaagcctcgccgagctttcccgcctggtgcgggag
ctcaaagagcgctacgggccccttcctgaggaggcggagaacttcgtggccctcgcccgg
ctccgcctggtggcggagaggaagggggtggtgtccatcacggagggcctcacccacctg
gaggtggtcttcccccgctaccccctggactacgacgcccgcggcctcaaggggcttccc
taccgggtggagcttacgcagtacccgcccgggttccgcctggagaagaagggcctgagg
ccccgggactaccccgaggccctgatggaggtgctctacctcttcgccgacctctag

DBGET integrated database retrieval system