KEGG   Thermus thermophilus HB8: TTHA1458
Entry
TTHA1458          CDS       T00220                                 
Symbol
TTHA1458
Name
(GenBank) conserved hypothetical protein
Organism
ttj  Thermus thermophilus HB8
SSDB
Motif
Pfam: NPCBM_assoc FixG_C CARDB DUF4832 MG2 ASH He_PIG fn3_6 Flg_hook E1_DerP2_DerF2 Wzt_C TRAP_beta
Other DBs
NCBI-ProteinID: BAD71281
UniProt: Q5SIB6
Position
1:1385044..1386189
AA seq 381 aa
MMRNVLALLAVLWSLALAQQYRGLALGTAYPEIGVQPGESVSLTLTLKSYGLPPGVVRLS
VPEVPAGWQAVLTGGGRLVRAVYLNPDQEASLTLRLQPPKEVKEGTYRFLVRAEGLGQTA
SLPITLMVGQGLPKRLSLEAELPVLKGPPTSSFRYRVTLRNESDQDLLVSLEYQAPQGFQ
VTFTPAFSSQQVTSLPVKAGESRDLDVEVSLPEDTPAGAYGVTLRAVAGDARADLALTLE
VTGRPEVRLSTKEGRLSGSVTAGRENAVKLVVKNEGSAPAKNLSFSAFEPSGWEVKFEPE
RLEVLEPGKEAEVTARIKPSSKAVAGDYMVTLRVSGDEGVSESLDYRATVVTSTLWGLVG
VALVAVAVLVLGFAVNRFGRR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatgcggaacgttctggcccttctcgcggtgctttggagcctagcgctggcgcagcag
taccggggtctggccctgggcaccgcctaccccgagatcggggtccagcccggggagagc
gtgagcctcaccctcaccctgaaaagctacggcctcccccccggggtggtgcgcctctcc
gtgcccgaggtcccggcggggtggcaggcggtgctcaccgggggcggccgcctggtgcgg
gccgtctacctgaaccccgaccaggaagcaagcctcaccctccgcctccagccgcccaag
gaggtcaaggagggcacctaccgcttcctcgtccgcgccgagggcctcggccagacggcg
agcctgcccatcaccctcatggtggggcaggggctccccaaacggctttccctcgaggcg
gagctccccgtcctcaaaggcccccccacgagctccttccgctaccgggtgacccttagg
aacgagtccgaccaggatctcctggtttccctggagtaccaggcgccccagggcttccag
gtgaccttcacccccgctttctccagccagcaggtgacgagcctccccgtcaaggccggg
gagagccgggacctggacgtggaggtctccctgcccgaggacacgcccgccggggcctac
ggggtgaccctccgagcggtggcgggggatgcccgggcggacttggccctgaccctcgag
gtcaccggccgccccgaggtgcgcctcagcaccaaggaggggcggctttccggctcggtc
accgccgggcgggaaaacgccgtgaagctcgtggtgaagaacgaggggagcgcccccgcc
aagaacctctccttcagcgcctttgagccctcgggctgggaggtgaagtttgagccggag
aggctggaggtcctggagccggggaaggaggcggaggtcaccgcccgcatcaagccctcc
tccaaggcggtggcgggggactacatggtgacccttagggtctccggggacgagggggtg
agcgagagcctggactaccgggccaccgtggtcacctccaccctctggggcctcgtgggc
gtggccctcgtggcggtggccgtcctcgttttgggcttcgccgtgaaccgcttcggccgg
aggtag

DBGET integrated database retrieval system