KEGG   Thermus thermophilus HB8: TTHA1492
Entry
TTHA1492          CDS       T00220                                 
Symbol
TTHA1492
Name
(GenBank) cell division protein FtsH
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
ttj  Thermus thermophilus HB8
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ttj01002]
    TTHA1492 (TTHA1492)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ttj03110]
    TTHA1492 (TTHA1492)
Peptidases and inhibitors [BR:ttj01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   TTHA1492 (TTHA1492)
Chaperones and folding catalysts [BR:ttj03110]
 Other chaperones and cochaperones
  AAA proteases
   TTHA1492 (TTHA1492)
SSDB
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 FtsH_ext AAA_22 RuvB_N AAA_16 IstB_IS21 AAA_5 AAA_2 AAA_33 TIP49 nSTAND3 AAA_17 AAA_18 LonB_AAA-LID AAA_14 AAA_28 Zeta_toxin NACHT Mg_chelatase Bac_DnaA AAA_7
Other DBs
NCBI-ProteinID: BAD71315
UniProt: Q5SI82
Structure
Position
1:1419132..1421006
AA seq 624 aa
MPRAPFSLLALVLGLAFLAWAFSLAGTVGAPSGTVNYTTFLEDLKAGRVKEVVVRAGDTR
IQGVLEDGSAFTTYAASPPDNATLEGWMARGVSVRVEPPQGQNALGFLWPLLLVGLLIGA
LYYFSRNGRAGPSDSAFSFTKSRARVLTEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSR
FHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVEMFVGVGAARVRDL
FETAKRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTAIVVMAA
TNRPDILDPALLRPGRFDRQIAIDAPDVKGREQILRIHARGKPLAEDVDLALLAKRTPGF
VGADLENLLNEAALLAAREGRRKITMKDLEEAADRVMMGPAKKSLVLSPRDRRITAYHEA
GHALAAHFLEHADGVHKVTIVPRGRALGFMMPRREDMLHWSRKRLLDQIAVALAGRAAEE
IVFDDVTTGAENDFRQATELARRMITEWGMHPEFGPVAYAVREDTYLGGYDVRQYSEETA
KRIDEAVRRLIEEQYQRVKALLLEKREVLERVAETLLERETLTAEEFQRVVEGLPLEAPE
EAREEREPPRVVPKVKPGGALGGA
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcctcgagccccctttagccttctcgccctggtcctgggcctcgccttcctggcctgg
gccttcagcctcgcgggcaccgtgggcgccccaagcgggacggtgaactacacgaccttc
ctggaggacctcaaggcgggccgggtcaaggaggtggtggtgcgcgccggggacacccgg
atccagggggtcctggaggacggctccgccttcaccacctacgcggcgagccctccggac
aacgccaccctcgagggctggatggcccggggggtgagcgtccgggtggagcccccccag
ggccaaaacgccctcggcttcctctggcccctcctcctcgtgggcctcctcatcggcgcc
ctctactacttctcccgcaacggccgggccgggccttcggactccgccttcagcttcacc
aaaagccgggcccgggtcctcaccgaggcccccaaggtcaccttcaaggacgtggccggg
gcggaggaggccaaggaggaactcaaggagatcgtggagttcctcaaaaaccccagccgc
ttccacgagatgggcgcccgcatccccaagggtgtcctcctggtggggcccccgggggtg
ggcaagacccacctggcccgggccgtggccggggaggcccgggtgcccttcatcaccgcc
tcgggctccgacttcgtggagatgttcgtgggggtaggggcggcgagggtccgggacctc
tttgagaccgccaagcgccacgccccctgcatcgtcttcattgacgagattgacgccgtg
gggaggaagcggggaagcggggtggggggcgggaacgacgagcgggagcagaccctgaac
cagctcctcgtggagatggacggctttgagaaggacacggccatcgtggtcatggccgcc
accaaccgccccgacatcctggaccccgccctgctccgccccgggcgctttgaccggcag
atcgccatagacgcccccgacgtcaagggccgggagcagatcctcaggatccacgcccgg
ggcaagcccctggcggaggacgtggacctggccctcctcgccaagcgcaccccgggcttc
gtgggggcggacctggagaacctcctgaacgaagccgccctcctcgccgcccgggagggg
cggaggaagatcaccatgaaggacctggaggaggccgccgaccgggtgatgatgggcccg
gccaagaaaagcctcgtcctctccccccgcgaccgcaggatcaccgcctaccacgaggcg
gggcacgccctggcggcccacttcctggagcacgccgacggggtgcacaaggtgaccatc
gtgccccggggaagggccttgggcttcatgatgcccaggcgggaggacatgctccactgg
tccagaaagcgccttttggaccagatcgccgtggccctggcggggcgggcggcggaggag
atcgtctttgacgacgtgaccacgggggcggagaacgacttccgccaggccacggagctc
gcccgccgcatgatcaccgagtgggggatgcaccccgagttcggccccgtggcctacgcg
gtgcgggaggacacctacctgggcggctacgacgtgcgccagtactcggaggagaccgcc
aagcgcattgacgaggcggtgcgccgcctcattgaggagcagtaccagagggtgaaggcc
cttctcctggaaaagcgggaggtcctggagcgggtggcggagaccctcctggagcgggag
accctcaccgccgaggagttccaacgggtggtggaggggctccccttggaggcccccgag
gaggcccgggaggagcgggagcccccccgggtggtgcccaaggtgaagccggggggcgcc
ctgggcggggcctga

DBGET integrated database retrieval system