KEGG   Tupaia chinensis (Chinese tree shrew): 102495614Help
Entry
102495614         CDS       T02978                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:tup00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102495614 (ABHD6)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102495614 (ABHD6)
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S33
   102495614 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 DLH Lipase BAAT_C Esterase Thioesterase
Motif
Other DBs
NCBI-GeneID: 102495614
NCBI-ProteinID: XP_006169230
UniProt: L8Y656
Position
Un
AA seq 335 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIKIYYWYWRRTLGMQVRYVYHEDYQF
CYSFRGRPGHRPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVSSLSLVCPAGLQYST
DNKFIQRLKELQDSSAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSERSRYALHKNMDKIKAPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIVDFLASVHSDNKKLD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgatgtggttaacatgtttgtgattgcgggcggaacgctggccatcccgatc
ctggcctttgtagcctcattcctcctgtggccttcagcactgataaaaatctattactgg
tactggcggaggacgctgggcatgcaggtccgatatgtctaccacgaagactaccagttc
tgttactccttccggggcaggccggggcacagaccctccatcctcatgctccacggattc
tctgcacacaaggacatgtggctcagcgtggtcaagtttcttccaaagaacctgcacttg
gtctgcgtagacatgccaggacacgagggcaccacccgctcctccctggatgacctatcc
atagatgggcaagtcaagagaatacaccagtttgtagaatgcctcaagctgaacaaaaaa
cccttccatctgataggcacctctatgggtggccatgtggctggggtatatgcagcttac
tacccatcagatgtttccagcctgagtcttgtgtgccccgccggcctgcagtattcaact
gataataaattcatccaacggctgaaagaactgcaggactcatccgccgtagagaagatt
cccttgatcccctccacaccagaagagatgagcgaaatgctccagctctgctcctatgtc
cgcttcaaggtaccccagcagatcctgcaaggcctcgtcgatgtccgcatccctcataac
aacttctaccggaagttgtttttggagatcgtcagcgagaggtccagatacgctctccat
aagaacatggacaagatcaaggccccaacacagatcatctgggggaagcaagaccaggtg
ctggatgtgtctggggccgacatgttggccaagtcgattgccaactgccaggtggagctt
ctggaaaactgtgggcactcggtggtgatggagagacccaggaagacggccaagctcatc
gtcgacttcctggcgtccgtgcacagtgacaacaagaagctggactga

DBGET integrated database retrieval system