KEGG   Tetranychus urticae (two-spotted spider mite): 107365960Help
Entry
107365960         CDS       T04901                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tut04131]
    107365960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107365960
Membrane trafficking [BR:tut04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    107365960
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107365960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6
Motif
Other DBs
NCBI-GeneID: 107365960
NCBI-ProteinID: XP_015789028
UniProt: T1KN95
Position
Unknown
AA seq 408 aa AA seqDB search
MVKFETYLSTSLILSLFSFKSICSAEVFQLNSQNFDQITSQYELVFVNFYADWCRFSQIL
SPVFEEAYSTILKEFPEPNRVLFGKVDCENQGSLAAKFHISKYPTLKVFINNKVGKREYR
GQRSVEAITNHIRDLLKDPVKPISTHEDHNNIEEKKGAIIGYFNVPPATTNEYVTFRKVA
TDLKGDCNFYWVTGEPSISHLQAGKQNFIIFKPSRVRPGEQDIIYPGTLQSYDEFSTWST
DKCIPLVREITFENAEELTEEGLPFLILFHAPEDRQSVDTYTNIVHRELYSESSNINFLT
ADGHKFAHPLHHLGKTLKDLPLIAIDSFRHMYLFPNFNDINISGKLKQFIQDLHSGKLHR
EFHFGPDPANDDKDNSNDNQIITSPPESTFKKLAPSRNRYTLLVKDEL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatttgaaacctacctgtcaacatcgttaattctatctctcttctcctttaaa
agtatatgctcagctgaggtcttccagttaaattcacaaaattttgaccaaatcacatct
caatatgaattagtatttgtaaatttttatgccgattggtgcaggttcagtcaaattcta
tctcctgtcttcgaagaggcatattcaacaatattgaaagaatttccagagccaaatcgt
gttctttttggaaaagttgattgtgaaaatcaaggttcacttgcggctaaatttcatatc
agcaaatatcctactttgaaagtttttatcaataataaagttggtaaaagggaataccga
ggccaaaggagtgtcgaggcaataacaaaccatatacgtgatctgttaaaggatcctgtt
aaaccaataagcacacatgaagatcacaataatattgaggagaagaaaggtgccataatt
ggttacttcaatgttcctccagctactaccaacgagtatgttacgttccgtaaggtagca
actgatttgaagggcgactgtaatttttattgggtgactggggaaccatcaatctctcat
ctacaagctggaaagcaaaattttatcatttttaaaccttctcgtgttcgtccaggagaa
caggatattatataccctggtactctacaaagttatgatgaattcagcacttggtcaact
gataagtgtattccattggtacgagaaataacctttgagaatgctgaagaattaacagaa
gaaggattgcctttcttaattctattccatgctcccgaagatcgacaatctgttgataca
tacaccaacatagtacatagagaactgtatagtgaatcatccaatatcaacttccttaca
gcagatggacataaatttgcccatccgttgcatcatcttggaaagactctcaaagattta
cctttaattgcaattgatagttttaggcatatgtacctttttcctaatttcaatgatatc
aacatctctggaaaactgaaacaatttattcaagatctgcatagtggaaaacttcataga
gagtttcattttggacccgacccagccaatgatgataaagacaactccaacgataatcaa
attataacatctcctcctgagtcaacattcaaaaaattagcaccatctagaaatcgatac
accttgctagttaaagatgaattgtga

DBGET integrated database retrieval system