KEGG   Ursus arctos horribilis: 113245887Help
Entry
113245887         CDS       T05909                                 

Gene name
SEPT5
Definition
(RefSeq) septin-5 isoform X1
  KO
K04557  septin 5
Organism
uah  Ursus arctos horribilis
Pathway
uah05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:uah00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    113245887 (SEPT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uah04131]
    113245887 (SEPT5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:uah04812]
    113245887 (SEPT5)
Membrane trafficking [BR:uah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    113245887 (SEPT5)
Cytoskeleton proteins [BR:uah04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     113245887 (SEPT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU Roc Ras AAA_16 AAA_22 AAA_29 NACHT ABC_tran
Motif
Other DBs
NCBI-GeneID: 113245887
NCBI-ProteinID: XP_026342010
UniProt: A0A3Q7UPE4
Position
Unknown
AA seq 369 aa AA seqDB search
MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTL
VHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSE
CWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHE
KVNIVPLIAKADCLVPGEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKE
SAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTC
DVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQ
KMKQQMQDQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcctgcggtacaagagcaagctggcgaccccagaggacaagcaggatatc
gacaagcagtacgtgggcttcgccacactgcccaatcaggtgcaccggaagtctgtgaag
aagggctttgatttcacgctcatggtggccggtgagtcgggcctggggaagtccacactg
gtccacagcctcttcctgaccgacttgtacaaggaccggaagctgctcagtgctgaggag
cgcatcagccagactgtggagatcctgaagcacacggtggacattgaggagaagggggtg
aagctgaagctcaccattgtagacacacccggcttcggggatgctgtcaacaactctgag
tgctggaagcccatcaccgactacgtggaccagcagtttgagcagtatttccgcgacgag
agcggcctcaaccgcaagaacatccaagacaaccgcgtgcactgctgcctgtacttcatc
tccccttttgggcacgggctgcggcccgtggatgtgggtttcatgaaggccctgcatgag
aaggtgaacatcgtgcccctcatcgccaaagctgactgtctcgtccccggtgagatccgg
aagctgaaggagcggatccgggaggagattgacaagttcggtatccatgtgtaccagttc
cccgagtgtgactccgacgaggatgaggactttaagcagcaagatcgggagctgaaggag
agcgcgcccttcgcggtgatcggcagcaacacagtggtggaggccaaagggcagcgggtc
cgggggcgactgtacccctgggggatcgtggaggtggagaaccaggcccactgcgacttc
gtgaagctgcgcaacatgctcatccgcacgcacatgcacgacctcaaggacgtgacgtgc
gacgtgcactacgagaactaccgcgcgcactgcatccagcagatgaccagcaaactgacc
caggacagccgcatggagagccccatccccatcctgcccctgcctacgcccgacgctgag
acagagaagctgatcaggatgaaggacgaggagctaaggcgcatgcaggagatgttgcag
aagatgaagcagcagatgcaggaccagtga

DBGET integrated database retrieval system