KEGG   Ursus maritimus (polar bear): 103670658Help
Entry
103670658         CDS       T03271                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00510  N-Glycan biosynthesis
umr00514  Other types of O-glycan biosynthesis
umr01100  Metabolic pathways
Module
umr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:umr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103670658 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    103670658 (ST6GAL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:umr01003]
    103670658 (ST6GAL2)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     103670658 (ST6GAL2)
Glycosyltransferases [BR:umr01003]
 Terminal extension
  Sialyltransferase
   103670658 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 103670658
NCBI-ProteinID: XP_008697355
UniProt: A0A384CSC0
Position
Un
AA seq 386 aa AA seqDB search
MKPHLKQWRQRMLCGIFAWGLLFVVIFVYFTDSNPAEPAPSSFSFLETRRLLPMQGKQRA
IMGAMQEPSLPESAGAHKGLLDGRPSGPFQKGPGDLPQWAQVRDGFENDEEFFSSQIGRK
SQSAFYPEDDDYFFAAGQPGFRSENFALMLFLNYVDLTAKIYSKFVTYVSLDSHDAVLRF
NSAPTRGYEKDVGNKTTVRIINSQILTNPNHHFIDSSLYKDVILVAWDPAPYSANLNLWY
KKPDYNLFTPYVQHRQRNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILI
MMSMCSEVHVYEYIPSIRQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQGDL
HRKGKVVLPGLRAVRCPAPNPAGPPS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaaagaatgctttgcgggatattcgcctggggg
ctcctcttcgtggtgattttcgtttacttcaccgacagcaacccagccgagcctgcgccc
agctccttctccttcctggagaccaggaggctcctgcccatgcaggggaagcagagggcc
atcatgggtgccatgcaggagccctccttgcccgagagtgcgggtgcacacaaggggctg
ctggacggacgcccgtcgggccccttccagaaggggcccggcgacctgccacagtgggct
caggtgcgggacgggtttgaaaatgatgaagagttcttttcatcccagatcgggagaaaa
tcgcaaagtgctttctacccggaggacgacgactacttttttgccgccggtcagccaggc
ttcaggtctgaaaattttgctttgatgctttttctaaattatgttgatttgacagcaaaa
atatacagtaagtttgtcacttatgtgtccttagattctcatgatgcagttttgagattt
aactctgctcctacacgtggctacgagaaagatgttggaaataaaaccactgtccgcatc
attaattcccagattctgaccaaccccaatcaccacttcattgacagttcgttgtataaa
gatgtcattttagtggcctgggatcctgctccttattctgcaaatcttaatctgtggtac
aagaagccagattacaacctgttcactccatatgttcagcaccgtcagagaaacccaaat
cagccattttacattcttcatccaaaatttatatggcaactttgggacattatccaggag
aacaccaaggagaagattcagcccaacccgccatcttccggcttcattggaatcctcatc
atgatgtccatgtgcagcgaagtgcacgtgtatgaatacatcccgtccatccggcagacg
gagctgtgccactaccacgagctgtactacgacgcggcgtgcacgctcggcgcctaccac
ccgctgctctacgagaagctgctcgtgcagcggctgaacaccggcgcccagggcgacctg
caccgcaaggggaaggtggtcctgcccgggctccgggccgtgcgctgccccgcgcccaac
cccgccggtccgccctcttga

DBGET integrated database retrieval system