KEGG   Ursus maritimus (polar bear): 103671819
Entry
103671819         CDS       T03271                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
umr  Ursus maritimus (polar bear)
Brite
KEGG Orthology (KO) [BR:umr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103671819 (ANKRD53)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103671819 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 103671819
NCBI-ProteinID: XP_008698705
UniProt: A0A384CW41
Position
Un
AA seq 490 aa
MQPAEKVSYKVTCSDAASQQPRAASPDPDPAFPLACPLPTLHPCAHAKPDDEWDQSAIGS
YYELFAAALGNLEWLRFCLSRDRDKIPADDKGFTAIHFAAQSGKLPCLQLLVEEYQFPVD
LPTSNGQTPLHLVIHGDNKTMTLPCIHYLLKRGAALNTQTSNGSTPLHLAACKGLLSCVK
VLVQNGANVHARDTVGCKPIDYCKIWNHRDCARFLKDAMWKRDKKDFAREMGKLKRLKDQ
LAFMEQDYLTEYQKEHQILREADFKKWLHCKQLLRGQTLICKAKQVPCAAPQAIPVSKTS
KHQRPWKSFYPSPEARLRQTSGPKLQPLGTPTPIYTHPMVRRPKSWNVSNNPARLPTTQI
GYPQGIRLGVHPDPSPEQDFRGFLEVRSDRHGGAQLCTVAGHRVAPVPQLPFEVIVRELH
PSVWPPRMKVPQGFCPVSMRNVPQKRHLGDDNFWTDTLAMNLRETFDEAFLAAVRAHQGL
PTLPSPKSPP
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcagccggcggagaaagtctcgtacaaggtcacatgttccgacgcggcgtcccagcag
cccagggccgccagcccagacccagacccggctttcccgctcgcctgcccactcccgacc
ctccatccctgcgcccacgctaagcccgatgatgagtgggaccagagtgccattgggagc
tactacgagttgttcgcggccgcactgggcaacctggaatggttgcgcttctgtctgagt
cgggaccgggacaaaattccggcagatgacaagggcttcaccgccatccactttgcagcc
cagagtggcaagctgccgtgcctgcagctcttggtagaggagtaccagtttcccgtggac
ctgcccaccagcaatggccagacacccctgcacctggtcatccacggggacaacaagacc
atgaccctcccctgcattcactatctacttaagcgaggggcggccctcaacactcagaca
agcaatggctccacacccctccacctggcagcctgcaagggcttgctgagctgcgtgaag
gtgctggtgcaaaatggtgccaatgtccatgcccgagacaccgtgggctgcaagcccatc
gactactgcaaaatatggaaccaccgcgactgtgcccggttcttgaaggatgccatgtgg
aaacgggacaagaaggactttgctcgtgagatggggaaactgaagaggctcaaggaccag
ttggccttcatggaacaggactacctgactgagtatcaaaaagagcaccaaattctgaga
gaagctgatttcaagaagtggctccattgcaagcagctgctccggggccaaaccctgatc
tgcaaggccaagcaagtgccttgtgccgcacctcaggcgatccccgtctccaagacctcc
aagcaccagaggccttggaagagcttctacccctccccagaggcacgcctgaggcagaca
tcagggcccaagctgcagcccttggggacacccacacccatctacacccaccccatggtc
agacggcccaagtcgtggaatgttagcaataaccctgccagattgccaaccacccagatc
ggctacccacagggcatccgcctgggtgtgcatccagaccccagcccagagcaagacttc
cgcggcttcctggaggtgaggtctgacaggcacggcggtgcgcagctgtgcacggtggcc
ggccaccgggtggcgcctgtgccccagctgcctttcgaggtgatagtccgagagctgcac
ccttcagtgtggccacccaggatgaaagtgccccagggcttctgccctgtcagcatgagg
aatgtgccccagaagcggcacttgggtgacgacaacttctggaccgacactctggccatg
aacctccgtgagacatttgatgaagccttcctggcagctgtgcgagcccatcaagggctc
cccactctgccctcccccaaaagccccccataa

DBGET integrated database retrieval system