KEGG   Vibrio cholerae O1 2010EL-1786: Vch1786_II0916
Entry
Vch1786_II0916    CDS       T01650                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vce  Vibrio cholerae O1 2010EL-1786
Pathway
vce03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Vch1786_II0916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vce02044]
    Vch1786_II0916
Secretion system [BR:vce02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Vch1786_II0916
SSDB
Motif
Pfam: Phage_GPD Phage_base_V PG_binding_1 DUF2345 PG_binding_3
Other DBs
NCBI-ProteinID: AET29334
Structure
PDB: 
4NOO 4NSO

Position
2:910413..913466
AA seq 1017 aa
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQ
QSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFRE
EQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
NT seq 3054 nt   +upstreamnt  +downstreamnt
atggcaaggttacagtttcaattaaaggtggatggccttgaggatgaatccctcgtcgta
cgcggatttgaagggcaagagtccttgtctgattctgtatggcgctgtgaaccctgctat
ggttttcgctatcaggttgatttagccagtgcgctaagcaaccttactgctgagcaattt
gtcgaccaaaccgcgcatttaaccattctgcgtgacgggcaagtggtgcagcaaattaac
ggtatcgtacgccaattgagtaaaggcgatactgggcatcggcacacgttttattctctt
acgttagtacctgcgctggagcggctttctttacgcagtaatagccgtattttccagcag
caaagcgtgccggaaattatctctattttactgcaagagatggggattgaagattacgcc
tttgcccttaagcgtgagtgtgcccagcgtgagttttgtgtgcagtaccgtgaaacggat
ttgcagtttttacaccgtatcgccgccgaagaaggcttggtatacagtcacctacatgaa
gcgcagaaacacacgctactgtttaccgatagctcggacagccaaccgaagttagccaag
ccagtaccttataatgcgctggcgggtggcgagatcaatctcccttatgtggtcgatctg
caattcaagaccaccgcacaagtcagccataccgagctaaaggattacagctttaaaaag
ccagcttacggatttactcagcgcacgcagggtaaagatatcgcttatcagcagccaaat
tatgagcattttgatgctccgggacgctacaaagacgatgcaaatggcaaggcctttagc
caaattcgcttagagtatttacgtcgcgatgctttgcttgctgatgcgaagagtgacgaa
cctttgctgttggcgggagtgcgttttgacttgcaagatcaccttgatcacgcaatgaat
cgagattggctcgtggtacaagccaatcaccaagggacgcagccacaagcgttacaagaa
gagggtggttcaggcgctaccacttacagcaatcagctaaaacttattcccgctcacatc
acttggcgagcaaggccttgtgctaagccgcaagtggatggtcccatgatcgccaccgtg
gttgggccacaaggtgaagagatttattgcgataactttggtcgcgtgaaagtgcatttc
ccgtgggatcgctactcaagtagcaacgaaaaaagctcttgctgggtgcgagtggcacaa
gaatgggctggtagccaatacggtagtatggcgattccgcgagttggccatgaagtgatt
gtttcgttcctgaatggcgatccggatcaacccatcatcacaggtcgtacgtatcatgcg
accaataccgcgccttacgccttgcctgaccacaaaaccaaaaccgtgctgcgcactgag
actcaccaagggcaaggctacaacgaactgagttttgaggatcaagcgggcagcgaacag
attttgctgcatgcacaaaaagattgggatgcgttgattgagcatgatcacaccgaagtg
attcgccacgatcaacatctcactgtggacaatgatcgctttacccgcattcagcgcaac
caacatttaacggttgaaggtgaagtccgtagcaaaatcgcactcgatagcagccatgaa
gtcggcgcgtcactacaacacaaagtcgggcagcgcattgctgtcgaggcgggtaaagag
atttcactcaaaagcggcgcaaaaatcgtggttgaagccggagcggagttaaccctaaaa
gctgggggcagttttgtaaaagtcgatgctggtggcgtgcacttagtcggtcctgccatt
aacctaaacgcgggcggcagtgcaggcagcggtagcgcttatggcgggcaattagcggca
gcaccgagaatgttagcgcaagctaaaccagtagcagaattggttcagccggatattgcg
gcctcaatgcaatcaggcgcggcgcgtgttattgatgtggcatcactccccacaatgatg
ccgagttcagccaataacacggcaaatgatgagcctgtggccgaagagaaaacaccggag
cgaattttaaaatccgatctcctcaaaccatccgatgagttagagaaactcgccaagcga
caagcgagtgcttatcgtcaaggtaatcacagcgatgaggttaagttactacaagaagcg
ctcataaaattggggtttgatctcgggaaagcaggagctgatggtgactttgggagcaaa
actaaaaccgcgattgagcagttccagaaaagctatcaaccaagccaccaaacccacccg
tcttacagcattggcgctgttgacggtattgtcggcaaaggtacactactggcactagac
gaagccttgatggatgggtgggtgtatgagaataatatttatcaaatatggcctctaggt
aaaacgtcagagaaatatgagtcggcaggaagaggcccaggggttatatcaacaggaaat
ggagattatggtggggcttcatatggttgctatcaaatgtcatcaaatcttggtgtggta
caaaaatatattcagtcatcaaaattcaaagaattctttagtggattaaatcccgctacg
aaagagtttaatgttgtttggcaggatatagcttcaagatatcctcaggaattcagagaa
gaacaacaccaatttattaagagaactcattatgatatacaaataggacatcttagaggg
aaaggacttttgtttgaacataatcgagctgctgtacatgatttgatctggtctacttca
gtacagtttggtgggagaactaatttgattttcaatgcattgaatggacaaaatatggaa
agtatgactgataaggacatcattattctggtacaagattacaagcttgttaatacagaa
aggctttttaagtcttcgccatcatggtggagtgatttaaaaaaacgtgcggtatcagag
aaaaaagctttacttgaactagaaattgacggtttggaggttgatataaaatga

DBGET integrated database retrieval system