KEGG   Vibrio cholerae O1 MJ-1236: VCD_002616Help
Entry
VCD_002616        CDS       T00903                                 

Definition
(GenBank) type I site-specific deoxyribonuclease HsdR family
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:vcj02048]
    VCD_002616
Enzymes [BR:vcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     VCD_002616
Prokaryotic defense system [BR:vcj02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   VCD_002616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3387 HSDR_N ResIII DUF87 DUF3050 Spore-coat_CotD
Motif
Other DBs
NCBI-ProteinID: ACQ60782
Position
1:complement(1756790..1760572)
Genome map
AA seq 1260 aa AA seqDB search
MKFTEERLEQAIIELLGKEGYPHTRGEVIERAPEDVLIKSDLREFLAKRYQAEGITAYEI
EQIIHKLEYLPASDLYDTNKAIMKFVSDGFLLKREDATQKDLYIQLIDYVDLENNRYRIV
NQMEIQGYELRIPDGILYINGLPLVVFEFKSAIREEATIYDAYKQLTTRYDRDIPELFKY
NALCVISDGVNSKMGSYFAPYEFYYSWRKITGAEKLDKDGIDSLFTMISGLFNKKRFTDV
IRHFIYFPDTSSKQEKIVCRYPQYYAATKLFANIKKHMKCFDEHGKLVSGDGKGGTYFGA
TGCGKSYTMLFLSRLLMKDVELGSPTIILITDRTDLDDQLSGQFTNAKGYVGDQNIISVE
SRAELREHLKGRKSGGVFLTTIHKFTEDLELLTERTNVICISDEAHRSQINLEQKITVTE
DGVKKTYGFAKYLHDSLPNATYVGFTGTPIDATLDVFGAVVDSYTMTESVFDEITVRIVY
EGRAAKVLLDGRQLEEVEKYYKACEEAGANEYQIDKSKTAMASMSTILGDPDRIKAIAKD
FVEHYEKRVEEGTTQKGKAMFVCSSREIAYQFYKELIALRPEWDEVKFCEDGATLSESDK
KKVKPMERVKMIMTRDNDDDKELWNKLGSKEYRKELDRQFKNGKSNFKIAIVVDMWLTGF
DVPFLDTIYIDKPLQKHNLIQTISRVNRKFEGKENGLVVDYIGIKKQMNLALSQYTAGQD
QNLEDIKQSVIIVKDHLSLLDGLFHKFDSKPYFNGTPLEQLHCLNASADFALRTKKFEKT
FMDLTKRLKSAYDICVGSSELTKTHKDKIHYYLAVRTIVFKITTGGAPDVEQMNRRVRDL
VKDALISDGVEEIFKLGEKDGGEIDIFDDDYLAKLEMIKQPNTKLQLLQQMLAKAIGEFK
KTNKVKGVDFTKKMNMLVEKYNERDEKDVLRSEVINDFSDEIINLYNELRAEMASFGEMG
INFEEKAFYDILISLAHKYDFTYPEDKLLELSKEVKKVIDDKAKYTDWNKRDDIKAELHF
DLIILLDEWGYPPIDRDEVYKEIFEQAENFKRNNPNRISNDVRPSEPIPMLLGDKKLYRA
SQVSRLANAQELATITFKAELPYERDFGSLFTTGYYSELKELGIVSSLVLDTTMTALSEL
EQATKELELPLYDGERSGIVWALQSARDGSIYDEFIAYAVEIAGDENFRTYIESAIYDAA
KASFWASFVLIPSIIRKKYQKRCEEKNAQTEIDEAIANSPNVVDFRKHSKWKNNSNNSIH
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacagaggaacggctagaacaagccattattgaactgctagggaaagaaggc
tatccacatactcgtggtgaagtgattgagcgagcacctgaagatgtgttgattaagtcc
gatcttcgtgaatttctagctaaacgttaccaagcggaaggtattactgcctatgagata
gagcaaattatccataagcttgagtatcttcccgcttcggatctgtacgataccaacaaa
gccatcatgaagtttgtctctgatggttttttgttaaagcgtgaagatgcaactcagaaa
gatttatacattcagcttatcgactacgttgacctagagaacaaccgctatcgcatcgtt
aaccaaatggagatacaaggctatgagctgcgtatccctgacgggattctttacatcaat
ggcttacctcttgtggtgtttgaatttaagagtgccattcgtgaagaagcgactatctat
gatgcgtataaacagctaactactcgttatgatcgagatatccctgaactattcaaatac
aacgctctgtgtgtgattagtgatggtgtgaacagcaaaatggggtcttactttgcccca
tacgagttttattactcttggcgcaaaattacgggtgcagagaagctagataaagacggt
attgattcactctttacgatgatcagcggtttgtttaacaaaaaacgattcacggatgtg
atacgtcactttatctacttccctgatacttcaagcaaacaagaaaagattgtttgtcgt
taccctcagtattacgcagcaaccaagcttttcgccaatatcaaaaagcatatgaagtgc
tttgatgagcacggtaagctggtgagtggtgatggtaaaggtggtacgtattttggcgca
actggttgtggtaagagctacaccatgttgttcttatctcgcctactgatgaaagatgtc
gaattaggtagcccaaccattattctcatcactgaccgtactgatctggatgatcagctt
tcaggtcaattcaccaacgcaaaaggttatgtaggtgatcaaaacatcataagcgtagag
agtcgtgctgaacttcgtgaacacttgaaagggcgtaaaagtggtggtgtattcctgact
accatccataaatttactgaagatttggagttgctgactgagcgaaccaacgtcatttgc
atctcggatgaagcgcaccgcagccaaatcaatttagaacagaaaattacagttactgaa
gacggggtgaaaaagacttacggctttgctaagtacctgcacgactctttacctaacgct
acttatgtcggctttactggcacaccgattgacgcaacgctggatgtatttggtgcggtt
gtcgatagctatacaatgacagaatctgtttttgatgaaattaccgttcgtatcgtttat
gaaggtcgagcagcaaaagtgttgcttgatggtcgccagcttgaagaagtcgaaaaatac
tataaagcctgtgaagaagcaggagcaaacgaatatcaaatagataaaagcaaaacggct
atggcgagtatgtctaccatactgggcgacccagatcgtattaaagccatagcaaaagac
tttgttgaacattatgagaagcgtgttgaagaaggcacgactcaaaaaggcaaagcaatg
ttcgtttgtagcagtcgtgaaatcgcttatcagttctacaaagaactgattgcgcttcgt
cctgagtgggatgaggtaaaattttgtgaagatggtgcaactttatcggaaagcgataag
aaaaaagttaagccgatggagcgagtcaagatgattatgactcgtgacaacgatgatgat
aaagagttgtggaataaactcggtagcaaagagtatcgtaaagagctggatcgtcagttt
aaaaatggcaaatcgaacttcaaaatcgcgattgtcgtggatatgtggttaacaggcttt
gatgtgccgtttctcgataccatctacattgataagccattgcaaaaacataatctgatc
caaaccatttcgagagtaaaccgtaaatttgaaggtaaagagaatggtctggtagtcgat
tacatcggcattaaaaaacagatgaaccttgctctttcccaatacacagcagggcaagat
cagaacctagaagacatcaaacagtcggtcattatcgttaaagatcacctaagtctgtta
gatgggctattccataagttcgattcaaagccatacttcaatggcactcccctagagcag
ttacattgcttaaatgcctcggctgattttgcacttagaaccaagaagtttgaaaagacg
tttatggatctgactaagcgcctcaaatcggcttatgacatttgtgtgggaagcagtgag
ctgactaaaacccataaagacaagattcattactatctagccgttcgtaccatagtattt
aaaatcaccactggcggtgcgccagatgtagagcaaatgaaccgcagagtaagggatttg
gttaaagatgctcttatcagtgatggagtcgaagagatctttaagctgggtgagaaagac
ggtggcgagattgatatttttgatgatgattatctcgccaaactggagatgatcaagcag
cccaatacgaaacttcaactgcttcagcaaatgcttgctaaggcgattggcgagtttaaa
aagaccaacaaagtgaaaggtgtcgatttcaccaagaaaatgaatatgttggttgaaaag
tacaatgagcgtgacgaaaaggatgtacttcgctcggaagtcattaatgatttttcagat
gaaattatcaacctttataatgaactacgtgctgagatggcctcatttggtgaaatggga
ataaattttgaagaaaaagcgttttacgacattctcatttcactggctcataagtacgac
tttacctacccagaagataagctgcttgaactgtcaaaagaggtaaaaaaagtcattgat
gataaagccaaatataccgattggaacaagcgagacgatataaaagctgaactgcatttc
gacttgattatcttgcttgatgaatggggatacccaccaatcgaccgtgatgaagtgtat
aaagagattttcgagcaggctgaaaactttaagagaaacaatcctaaccgcatcagtaac
gatgttcgaccatctgaaccaatcccgatgctactaggagataaaaaactctatcgcgct
tctcaagtttctcggcttgctaatgctcaagaactagccacgattacgttcaaggcggaa
ttaccctatgagagggattttggttcgcttttcactacgggatattacagtgagcttaaa
gagttaggtattgtttcttcattggtgctagataccacaatgaccgctttgtcagagctt
gaacaagctacaaaggagctagaactacctttgtatgatggagagcgtagtggcattgtc
tgggcgttacagtctgctagagatggaagtatatatgacgagtttatcgcttatgctgtc
gaaatcgcgggagacgagaattttcgtacatacattgaaagtgctatttatgatgccgca
aaagcttcattttgggcatcattcgttttgatacccagcatcatacgcaaaaagtaccaa
aaacgttgtgaagaaaaaaatgctcagacagagatcgatgaggccatcgccaatagcccg
aatgtcgttgattttaggaaacatagtaaatggaagaacaactcgaataattccattcat
taa

DBGET integrated database retrieval system