KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0110
Entry
VCLMA_B0110       CDS       T01871                                 

Definition
(GenBank) VgrG-3 protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCLMA_B0110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcl02044]
    VCLMA_B0110
Secretion system [BR:vcl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCLMA_B0110
SSDB
Motif
Pfam: Phage_GPD Phage_base_V PG_binding_1 DUF2345 PG_binding_3
Other DBs
NCBI-ProteinID: AEA79756
Structure
PDB: 
4NSO

Position
II:134938..137457
AA seq 839 aa
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTIRRDGQVVQQINGIVRQFSKGDTGYRHTFYSLTLVPALERLSLRSNSRIFQQ
QSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGPVDGIVGKGTLLALDEALMDGWVYENDEMDLKWLTVPKGQLTFDAEGNDVDSST
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggcaaggttacagtttcaattaaaggtggatggccttgaggatgaatccctcgtcgta
cgcggatttgaagggcaagagtccttgtctgattctgtatggcgcagtgaaccctgctat
ggttttcgctatcaggttgatttagccagtgcgctaagtaacctcacggctgagcaattt
gtcgaccaaaccgcgcatttaaccattcggcgtgacgggcaagtggtgcagcaaattaac
ggtatcgtacgccaattcagcaaaggcgatactgggtatcggcacacgttttattctctt
acgttagtacctgcgctggagcggctttctttacgcagtaatagccgtattttccagcag
caaagcgtgccggaaattatctctattttgctgcaagagatggggattgaagattacgcc
tttgcccttaagcgtgagtgtgcccagcgagagttttgtgtacagtatcgtgaaacggat
ttgcagtttttacaccgaatcgccgccgaagaaggcttggtttacagccacctacatgaa
gcgcagaaacacacgctactgtttaccgatagctcggacagccaaccgaagttagccaag
ccagtaccttataatgcgctggcgggtggcgagatcaatctcccttatgtggtcgatctg
caattcaagaccaccgcacaagtcagccataccgagctaaaggattacagctttaaaaag
ccagcttacggatttactcagcgcacgcagggtaaagacatcgcttatcagcagccaaat
tatgagcattttgatgctccgggacgctacaaagacgatgcaaatggcaaggcctttagc
caaattcgcttagagtatttacgccgcgatgctttgcttgctgatgcgaagagtgacgaa
cctttgctgttggcgggagtgcgttttgacttgcaagatcaccttgatctcgcaatgaat
cgagattggctcgtggtacaagccaatcaccaagggacgcagccacaagcgttacaagaa
gagggtggttcaggcgctaccacttacagcaatcagctaaaacttatccccgctcacatc
acttggcgagcaaggccttgtgctaagccgcaagtggatggtcccatgatcgccaccgta
gttgggccgcaaggtgaagagatttattgcgataactttggtcgtgtgaaagtgcatttc
ccgtgggatcgctactcaagtagcaacgaaaaaagctcttgctgggtacgagtggcacaa
gaatgggcgggtagccaatacggtagtatggcgattccgcgagtcggccatgaagtgatt
gtttcgttcctgaatggcgatccggatcaacccatcatcacgggtcgtacgtaccatgcg
accaataccgcgccttacgccttgcctgaccacaaaaccaaaaccgtactgcgcactgag
actcaccaagggcaaggctacaacgaactgagttttgaggatcaagcgggcagcgaacag
attttgctgcatgcacaaaaagattgggatgcgttgattgagcatgatcacaccgaagtg
attcgccacgatcagcatctcactgtggacaatgatcgctttacccgcattcagcgcaac
caacatttaacggttgaaggtgaagtccgtagcaaaatcgcactcgatagcagccatgaa
gtcggcgcgtcactacaacacaaagtagggcaacgcattgctgtcgaggcgggcaaagag
atttcactcaaaagcggcgcaaaaatcgtggttgaagccggagcggagttaaccctaaaa
gcagggggcagctttgtaaaagtcgatgcaggtggcgtgcacttagtcggtcctgccatt
aacctaaacgcgggcggcagtgcaggcagcggtagcgcttatggtgggcaattagccgca
gcaccaagaatgttagcgcaagctaaaccagtagctgaattggttcagccggatattgct
gcctcaatgcaatcaggcgcggcgcgtgttattgatgtggcatcactccccactatgatg
ccgagttcagccaataacacggcaaatgatgagcctgtggccgaagagaaaacaccggag
cgaattttaaaatccgatcttctcaaaccatccgatgagttagagaaactcgccaagcga
caagcgagtgcttatcgtcaaggtaatcacagcgatgaggttaagttattacaagaagcg
ctcataaaactggggtttgatctcgggaaagcaggagctgatggtgactttggcagtaaa
actaaaaccgcgattgagcagttccagaaaagctatcaaccaagccaccaaacacacccg
tcttacagcattggccccgttgacggtattgtcggcaaaggtacactactggcactagac
gaagccttgatggatgggtgggtgtatgaaaatgatgagatggatttgaaatggttgact
gtacccaaaggtcagctcacttttgatgccgaagggaatgatgttgattcatcaacttag

DBGET integrated database retrieval system