KEGG   Vibrio cholerae O1 O395: VC0395_0014
Entry
VC0395_0014       CDS       T00520                                 

Gene name
vgrG-3
Definition
(GenBank) vgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC0395_0014 (vgrG-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_0014 (vgrG-3)
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_0014 (vgrG-3)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V PG_binding_1 DUF2345 PG_binding_3
Other DBs
NCBI-ProteinID: ABQ18344
UniProt: A0A0H3ADL3
Structure
PDB: 
4NOO 4NSO

Position
1:complement(12071..15124)
AA seq 1017 aa
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQ
QSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFRE
EQHQFIKRIHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
NT seq 3054 nt   +upstreamnt  +downstreamnt
atggcaaggttacagtttcaattaaaggtggatggccttgaggatgaatccctcgtcgta
cgcggatttgaagggcaagagtccttgtctgattctgtatggcgctgtgaaccctgctat
ggttttcgctatcaggttgatttagccagtgcgctaagcaaccttactgctgagcaattt
gtcgaccaaaccgcgcatttaaccattctgcgtgacgggcaagtggtgcagcaaattaac
ggtatcgtacgccaattgagtaaaggcgatactgggcatcggcacacgttttattctctt
acgttagtacctgcgctggagcggctttctttacgcagtaatagccgtattttccagcag
caaagcgtgccggaaattatctctattttactgcaagagatggggattgaagattacgcc
tttgcccttaagcgtgagtgtgcccagcgtgagttttgtgtgcagtaccgtgaaacggat
ttgcagtttttacaccgtatcgccgccgaagaaggcttggtatacagtcacctacatgaa
gcgcagaaacacacgctactgtttaccgatagctcggacagccaaccgaagttagccaag
ccagtaccttataatgcgctggcgggtggcgagatcaatctcccttatgtggtcgatctg
caattcaagaccaccgcacaagtcagccataccgagctaaaggattacagctttaaaaag
ccagcttacggatttactcagcgcacgcagggtaaagatatcgcttatcagcagccaaat
tatgagcattttgatgctccgggacgctacaaagacgatgcaaatggcaaggcctttagc
caaattcgcttagagtatttacgtcgcgatgctttgcttgctgatgcgaagagtgacgaa
cctttgctgttggcgggagtgcgttttgacttgcaagatcaccttgatcacgcaatgaat
cgagattggctcgtggtacaagccaatcaccaagggacgcagccacaagcgttacaagaa
gagggtggttcaggcgctaccacttacagcaatcagctaaaacttattcccgctcacatc
acttggcgagcaaggccttgtgctaagccgcaagtggatggtcccatgatcgccaccgtg
gttgggccacaaggtgaagagatttattgcgataactttggtcgcgtgaaagtgcatttc
ccgtgggatcgctactcaagtagcaacgaaaaaagctcttgctgggtgcgagtggcacaa
gaatgggctggtagccaatacggtagtatggcgattccgcgagttggccatgaagtgatt
gtttcgttcctgaatggcgatccggatcaacccatcatcacaggtcgtacgtatcatgcg
accaataccgcgccttacgccttgcctgaccacaaaaccaaaaccgtgctgcgcactgag
actcaccaagggcaaggctacaacgaactgagttttgaggatcaagcgggcagcgaacag
attttgctgcatgcacaaaaagattgggatgcgttgattgagcatgatcacaccgaagtg
attcgccacgatcaacatctcactgtggacaatgatcgctttacccgcattcagcgcaac
caacatttaacggttgaaggtgaagtccgtagcaaaatcgcactcgatagcagccatgaa
gtcggcgcgtcactacaacacaaagtcgggcagcgcattgctgtcgaggcgggtaaagag
atttcactcaaaagcggcgcaaaaatcgtggttgaagccggagcggagttaaccctaaaa
gctgggggcagttttgtaaaagtcgatgctggtggcgtgcacttagtcggtcctgccatt
aacctaaacgcgggcggcagtgcaggcagcggtagcgcttatggcgggcaattagcggca
gcaccgagaatgttagcgcaagctaaaccagtagcagaattggttcagccggatattgcg
gcctcaatgcaatcaggcgcggcgcgtgttattgatgtggcatcactccccacaatgatg
ccgagttcagccaataacacggcaaatgatgagcctgtggccgaagagaaaacaccggag
cgaattttaaaatccgatctcctcaaaccatccgatgagttagagaaactcgccaagcga
caagcgagtgcttatcgtcaaggtaatcacagcgatgaggttaagttactacaagaagcg
ctcataaaattggggtttgatctcgggaaagcaggagctgatggtgactttgggagcaaa
actaaaaccgcgattgagcagttccagaaaagctatcaaccaagccaccaaacccacccg
tcttacagcattggcgctgttgacggtattgtcggcaaaggtacactactggcactagac
gaagccttgatggatgggtgggtgtatgagaataatatttatcaaatatggcctctaggt
aaaacgtcagagaaatatgagtcggcaggaagaggcccaggggttatatcaacaggaaat
ggagattatggtggggcttcatatggttgctatcaaatgtcatcaaatcttggtgtggta
caaaaatatattcagtcatcaaaattcaaagaattctttagtggattaaatcccgctacg
aaagagtttaatgttgtttggcaggatatagcttcaagatatcctcaggaattcagagaa
gaacaacaccaatttattaagagaattcattatgatatacaaataggacatcttagaggg
aaaggacttttgtttgaacataatcgagctgctgtacatgatttgatctggtctacttca
gtacagtttggtgggagaactaatttgattttcaatgcattgaatggacaaaatatggaa
agtatgactgataaggacatcattattctggtacaagattacaagcttgttaatacagaa
aggctttttaagtcttcgccatcatggtggagtgatttaaaaaaacgtgcggtatcagag
aaaaaagctttacttgaactagaaattgacggtttggaggttgatataaaatga

DBGET integrated database retrieval system