KEGG   Vibrio cholerae O1 O395: VC0395_0573Help
Entry
VC0395_0573       CDS       T00520                                 

Definition
(GenBank) D-isomerspecific 2-hydroxyacid dehydrogenase family protein
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00260  Glycine, serine and threonine metabolism
vco00680  Methane metabolism
vco01100  Metabolic pathways
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
vco01200  Carbon metabolism
vco01230  Biosynthesis of amino acids
Module
vco_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    VC0395_0573
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VC0395_0573
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vco04147]
    VC0395_0573
Enzymes [BR:vco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     VC0395_0573
    1.1.1.399  2-oxoglutarate reductase
     VC0395_0573
Exosome [BR:vco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC0395_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABQ18685
UniProt: A0A0H3ADB2
Structure
PDB: 

Position
1:complement(627795..628766)
Genome map
AA seq 323 aa AA seqDB search
MKIAILDDYQNVVRGLNAFQCLQGHDVTVFNDSVSDETVLIERLKPFEALVLIRERTPIT
ENLLAHLPNLKLISQTGKVSNHIDVPLCERYGVTVLEGIGSPVAPAELCWSLILAASRHL
PSYIEQLHAGHWQQNGGLGLGRTLSGRTLGIWGLGKIGQRIAQFGHVFGMPILVWGSEAS
RQKALELGYQAAADKAEFFAKADVLSLHLRLNDATRGIVTKQDLLAMKPDSLFVNTSRAE
LVESGALYSVMQANPMRQAAVDVYENEPALPNNEPLLSLPNVLCAPHLGYVEKNSYEIYF
QAAFENVVKFAHSAAKASLSDKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcgattctggatgattaccaaaatgtggtgcgtggcttaaacgcctttcaa
tgcttacaagggcatgacgtcaccgtattcaatgatagtgtgagcgatgaaaccgtattg
attgagcgcctgaaaccttttgaggctttggtgctgatccgcgagcgcaccccaatcact
gaaaatcttttggctcatctgccgaatttgaaactcatcagccagaccggaaaagtcagc
aaccatattgatgtgcctctgtgtgagcgttatggcgtgaccgtgttagaaggcatcggc
tctcccgttgccccagcggagctgtgctggagtttaatccttgccgcttcgcgccatttg
ccaagttatatcgagcagttacacgcaggtcattggcaacaaaatggcggattaggctta
ggtcgaaccctctctggtcgcaccttgggcatttggggtttaggcaaaatcggtcagcgc
attgctcaatttggtcacgtatttggtatgccaatcttggtgtggggcagtgaagcctcg
cggcaaaaagcgcttgagttgggttatcaagccgccgccgataaagccgagttttttgct
aaagccgatgtactttcactccatttacgtttgaatgacgccacgcgtggcatcgtcacc
aaacaagatctgcttgccatgaaacccgattcgctgtttgtgaataccagccgagcggag
ttagtggaatcgggcgcactctactcagtgatgcaggctaacccaatgcgccaagccgcg
gtcgatgtgtacgaaaacgagcccgcgttacccaacaatgagccgctgctgagtttgccc
aatgtgctgtgcgcgccgcatctcggttatgtggagaaaaacagctacgagatctacttt
caggccgcgtttgagaatgtggtcaagtttgctcactcggccgcgaaagcgtcattgagc
gataaggcctaa

DBGET integrated database retrieval system