KEGG   Vibrio cholerae O1 O395: VC395_A0116Help
Entry
VC395_A0116       CDS       T02099                                 

Gene name
vgrG-3
Definition
(GenBank) vgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC395_A0116 (vgrG-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_A0116 (vgrG-3)
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_A0116 (vgrG-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD PG_binding_1 DUF2345 PG_binding_3 Phage_base_V
Motif
Other DBs
NCBI-ProteinID: ACP10960
Structure
PDB: 

Position
II:137595..140648
Genome map
AA seq 1017 aa AA seqDB search
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQ
QSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKR
QASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFRE
EQHQFIKRIHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNME
SMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggttacagtttcaattaaaggtggatggccttgaggatgaatccctcgtcgta
cgcggatttgaagggcaagagtccttgtctgattctgtatggcgctgtgaaccctgctat
ggttttcgctatcaggttgatttagccagtgcgctaagcaaccttactgctgagcaattt
gtcgaccaaaccgcgcatttaaccattctgcgtgacgggcaagtggtgcagcaaattaac
ggtatcgtacgccaattgagtaaaggcgatactgggcatcggcacacgttttattctctt
acgttagtacctgcgctggagcggctttctttacgcagtaatagccgtattttccagcag
caaagcgtgccggaaattatctctattttactgcaagagatggggattgaagattacgcc
tttgcccttaagcgtgagtgtgcccagcgtgagttttgtgtgcagtaccgtgaaacggat
ttgcagtttttacaccgtatcgccgccgaagaaggcttggtatacagtcacctacatgaa
gcgcagaaacacacgctactgtttaccgatagctcggacagccaaccgaagttagccaag
ccagtaccttataatgcgctggcgggtggcgagatcaatctcccttatgtggtcgatctg
caattcaagaccaccgcacaagtcagccataccgagctaaaggattacagctttaaaaag
ccagcttacggatttactcagcgcacgcagggtaaagatatcgcttatcagcagccaaat
tatgagcattttgatgctccgggacgctacaaagacgatgcaaatggcaaggcctttagc
caaattcgcttagagtatttacgtcgcgatgctttgcttgctgatgcgaagagtgacgaa
cctttgctgttggcgggagtgcgttttgacttgcaagatcaccttgatcacgcaatgaat
cgagattggctcgtggtacaagccaatcaccaagggacgcagccacaagcgttacaagaa
gagggtggttcaggcgctaccacttacagcaatcagctaaaacttattcccgctcacatc
acttggcgagcaaggccttgtgctaagccgcaagtggatggtcccatgatcgccaccgtg
gttgggccacaaggtgaagagatttattgcgataactttggtcgcgtgaaagtgcatttc
ccgtgggatcgctactcaagtagcaacgaaaaaagctcttgctgggtgcgagtggcacaa
gaatgggctggtagccaatacggtagtatggcgattccgcgagttggccatgaagtgatt
gtttcgttcctgaatggcgatccggatcaacccatcatcacaggtcgtacgtatcatgcg
accaataccgcgccttacgccttgcctgaccacaaaaccaaaaccgtgctgcgcactgag
actcaccaagggcaaggctacaacgaactgagttttgaggatcaagcgggcagcgaacag
attttgctgcatgcacaaaaagattgggatgcgttgattgagcatgatcacaccgaagtg
attcgccacgatcaacatctcactgtggacaatgatcgctttacccgcattcagcgcaac
caacatttaacggttgaaggtgaagtccgtagcaaaatcgcactcgatagcagccatgaa
gtcggcgcgtcactacaacacaaagtcgggcagcgcattgctgtcgaggcgggtaaagag
atttcactcaaaagcggcgcaaaaatcgtggttgaagccggagcggagttaaccctaaaa
gctgggggcagttttgtaaaagtcgatgctggtggcgtgcacttagtcggtcctgccatt
aacctaaacgcgggcggcagtgcaggcagcggtagcgcttatggcgggcaattagcggca
gcaccgagaatgttagcgcaagctaaaccagtagcagaattggttcagccggatattgcg
gcctcaatgcaatcaggcgcggcgcgtgttattgatgtggcatcactccccacaatgatg
ccgagttcagccaataacacggcaaatgatgagcctgtggccgaagagaaaacaccggag
cgaattttaaaatccgatctcctcaaaccatccgatgagttagagaaactcgccaagcga
caagcgagtgcttatcgtcaaggtaatcacagcgatgaggttaagttactacaagaagcg
ctcataaaattggggtttgatctcgggaaagcaggagctgatggtgactttgggagcaaa
actaaaaccgcgattgagcagttccagaaaagctatcaaccaagccaccaaacccacccg
tcttacagcattggcgctgttgacggtattgtcggcaaaggtacactactggcactagac
gaagccttgatggatgggtgggtgtatgagaataatatttatcaaatatggcctctaggt
aaaacgtcagagaaatatgagtcggcaggaagaggcccaggggttatatcaacaggaaat
ggagattatggtggggcttcatatggttgctatcaaatgtcatcaaatcttggtgtggta
caaaaatatattcagtcatcaaaattcaaagaattctttagtggattaaatcccgctacg
aaagagtttaatgttgtttggcaggatatagcttcaagatatcctcaggaattcagagaa
gaacaacaccaatttattaagagaattcattatgatatacaaataggacatcttagaggg
aaaggacttttgtttgaacataatcgagctgctgtacatgatttgatctggtctacttca
gtacagtttggtgggagaactaatttgattttcaatgcattgaatggacaaaatatggaa
agtatgactgataaggacatcattattctggtacaagattacaagcttgttaatacagaa
aggctttttaagtcttcgccatcatggtggagtgatttaaaaaaacgtgcggtatcagag
aaaaaagctttacttgaactagaaattgacggtttggaggttgatataaaatga

DBGET integrated database retrieval system