KEGG   Verticillium dahliae: VDAG_01561
Entry
VDAG_01561        CDS       T03450                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
vda  Verticillium dahliae
Pathway
vda00910  Nitrogen metabolism
vda01100  Metabolic pathways
Module
vda_M00531  Assimilatory nitrate reduction, nitrate => ammonia
vda_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    VDAG_01561
Enzymes [BR:vda01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     VDAG_01561
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C Pyr_redox_3
Other DBs
NCBI-GeneID: 20703024
NCBI-ProteinID: XP_009648742
UniProt: G2WSF8
Position
1
AA seq 1106 aa
MAERKKLVVVGLGMVGIAFIEKMLKLDARTRAYDIIVIGEESHLAYNRVGLTSFFDHRKV
ENLYMNPKEWYAAAPEGALGYHINTKVTDVDAKAKTVTCSNGEVVSYDSLVFATGSDAVL
PRHTPGHDAKGVFVYRTIDDLINLIEFAEHRKGTVGAVVGGGLLGLEAANAMMDLKCYDK
VKLIERNRWVLSRQLDADAGTMVVEQVRDLGLDVLLSKRVGKVEVDADNYVTGVLFEDGE
QMPCSTICFAIGIRPRDDLARKAGLKCADRGGGIIVGDDLSTSEPDIYAIGECASWQTQT
FGLIAPGVEMADVLSFNLTQAHLHSPRVFKTPDLSTKLKLLGVEVASFGDFFADRDGPKK
LPPRAKRANKENVQTALETLTNGLPPAPVKALTYRDPFSNVYKKYLFTEDGKYLLGGMMI
GDTRDYIKLVPMVKNMKVLEIPPSELILGAKKDGEDDGDDLSHDTQICSCHNVTKGDVVD
AVKDGSCTSIGDIKACTKAGTGCGGCMPLVTTIFNKTMASMGNEVKNHLCSHFKYSRAEL
YHIIMVKKLRTLAEVMREVGTEPDSLGCEACKPTIGGIFSSLWNRHVMDKPQHGLQETND
RFLGNIQRNGTYSVVPRMSGGEVTPAKLIVIGQVAAKYKLYTKITGGQRVDMFGARRQDL
PAIWRELIAGGMESGHAYAKSLRTVKSCVGSTWCRYGIGDSVGLAVRLEERYKSIRAPHK
IKGGVSGCVRECAEAQSKDFGLIATDKGFNIYVAGNGGVTPRHAELLAKDVPPTEVIPIL
DRYLMFYIRTGDKLQRTASWIQALPGGLKYLQEVVLEDKLGICASLEAQMQELVDSFFDE
WAEALATPSIINKFKQFANTDESVENVEIEAERDQERPVYWAPEAAKEDFKALKSRWTSK
EWEPLLAASYFAGADDAPNGISATIKRGDTQLAVWRVRGKYYATQQMCPHKRAFVLSEGL
IGEATGADTCSDAPKADSGCSTNGDAKKSAPWVSCPYHKRNFDLANGDCKNDGELSIATF
EAEERADGMVHVLLPPVAELDAELGTAKWKVKKGESGQAPFAGLDKAVGFKGIRGKKPGV
KPFAPLKMNRPVEVLAGGGCGSAPDW
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggcggagcgaaagaagcttgtggttgtcggcctgggcatggtcggcatcgccttcatc
gagaagatgctcaagctcgatgcccgcacacgcgcctacgacatcatcgtcattggggag
gaatcacatctggcctacaaccgtgtcggcctgacaagtttcttcgaccaccgaaaagtc
gagaacctctacatgaacccaaaagaatggtatgctgccgcacccgaaggagctctcggc
taccacatcaacaccaaagtcacagatgtcgacgccaaggccaagacggtgacatgttcc
aacggcgaggttgtttcctacgattccctcgtcttcgccaccggctccgatgccgtccta
ccccgccacacccccggacacgacgcgaaaggcgtcttcgtctaccgaacaattgacgat
ctgatcaacctcattgaatttgctgaacataggaaaggaaccgtcggcgccgttgtcggt
ggcggcctgcttggtctcgaggccgccaatgccatgatggatctcaagtgctacgacaag
gtcaagcttatcgaaaggaaccgatgggtgctcagccgtcagctcgacgccgatgctggt
accatggttgttgaacaggtccgggacctcggcctcgacgttctcctcagcaagcgcgtt
ggtaaggtcgaggtggatgccgacaactatgtcacgggcgttctgtttgaggacggcgag
cagatgccatgctccacgatctgctttgccattggcattcgaccgagagatgacctcgcc
cgcaaggccggtctcaagtgcgccgatcgtggcggtggtatcatcgtcggcgatgatctg
agcaccagcgagcccgatatttacgccattggcgagtgtgccagctggcagacccagaca
ttcggcctaatcgctcctggtgttgagatggccgacgtcttgtctttcaatctgacacaa
gctcacctgcactcgcctcgcgtcttcaagactccggatctgagcacaaaactcaagctg
cttggagtcgaagtcgccagttttggtgacttctttgctgatcgcgacgggcccaagaag
ctgccccctcgtgcgaagcgtgccaacaaggagaacgtgcaaacggctctcgagacgctc
accaacggcctaccgccagcaccagtcaaggccctgacctaccgcgaccccttctccaac
gtgtacaagaaatatctgttcacggaagatggcaagtaccttcttggtggcatgatgatt
ggcgacacacgcgattatatcaagcttgtacccatggtcaagaacatgaaagttctcgag
atcccaccgagcgagctcattcttggcgcgaaaaaggatggggaggatgatggtgacgat
ctatcccacgacacccaaatttgctcgtgccacaacgtgaccaagggcgacgtcgtcgac
gccgtcaaggacggctcatgcacgagcatcggcgacatcaaggcgtgcaccaaggccggc
acgggctgtggcggctgcatgcccctcgtgacgacaatcttcaacaagacaatggcgtca
atgggcaacgaagtcaagaaccacctgtgctctcacttcaaatactcgcgtgccgagctc
taccacattatcatggtcaagaagcttcgtacgctcgccgaggttatgcgcgaagtcgga
accgagcccgactcgcttggctgcgaggcctgcaagcccacaattggcggcatcttctcc
tcgctctggaaccgccacgtcatggacaagccccagcacggtcttcaagagaccaacgat
cgtttcctcggaaatattcagcgcaacggcacatactccgttgtgcctcgtatgtcgggt
ggtgaagtcactcctgcgaagctcattgtcatcggccaggtcgctgccaaatacaagctt
tacaccaagatcactggtggccagcgtgtcgacatgtttggtgcccgccggcaggacctg
cctgctatctggcgggagctcatcgctggaggcatggagtctggccacgcgtacgcgaaa
tcgctgcgtactgtcaagtcctgtgtcggaagcacgtggtgccgttacggtatcggcgat
tcggttggcctcgctgtccgtctcgaggagcgctacaagtccatccgagcgccgcacaag
atcaagggtggcgtcagcggttgcgtgcgtgagtgcgctgaagcgcagagcaaggatttt
ggcctcatcgccacggacaagggcttcaacatctacgttgccggcaacggtggtgttacg
ccgaggcacgcggagctacttgccaaggacgtaccgcccaccgaagtcatccctatcctt
gatcgctatctcatgttctacatccgcaccggagacaagcttcagcggacagcgagctgg
attcaagcgctgccgggtggcctgaagtatcttcaggaagtcgtgctcgaggacaagctc
ggcatctgtgcgtccctggaggcacagatgcaggagctcgtcgacagcttctttgacgaa
tgggctgaggcacttgcgacgccctcgatcatcaacaagttcaagcagtttgccaacacg
gacgagtcggttgagaatgtggagattgaggcggagcgcgaccaggagaggcccgtgtac
tgggcgccagaagcggccaaggaggacttcaaggcgctcaagtcacggtggacatcgaag
gagtgggagcctcttcttgctgcctcctactttgccggggccgacgatgcgccgaacggc
atctcggcgacgatcaagcgcggcgacacgcagctcgccgtgtggcgtgttcgcggaaag
tactatgccacgcagcaaatgtgcccgcacaagcgtgcctttgtgctgtcggaaggcctc
atcggcgaggctacaggcgcagacacgtgctcggacgcgcccaaggcggactccgggtgc
agcaccaacggcgacgccaagaagtcggcgccgtgggtgtcgtgcccctaccacaagcgc
aactttgacctcgccaacggcgactgcaagaacgatggcgagctgagcatcgcgacgttc
gaggccgaggagcgcgctgacggcatggtgcacgtgctgctgccgccggtggccgagctc
gacgccgaactcggtacggccaagtggaaggtcaagaagggagagtctggccaggcgccg
ttcgcgggcctcgacaaggccgttggtttcaagggcattcgcggaaagaagcctggcgtc
aagccctttgcgccgctcaagatgaacaggccagtggaggtgcttgccggaggcggatgc
ggaagcgcaccggattggtag

DBGET integrated database retrieval system