KEGG   Vibrio furnissii: vfu_B00784
Entry
vfu_B00784        CDS       T01680                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
vfu  Vibrio furnissii
Brite
KEGG Orthology (KO) [BR:vfu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vfu02044]
    vfu_B00784
Secretion system [BR:vfu02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   vfu_B00784
SSDB
Motif
Pfam: FHA Yop-YscD_cpl Peptidase_C30 ThiS
Other DBs
NCBI-ProteinID: ADT88997
Position
2:complement(815080..816069)
AA seq 329 aa
MTISFQIIDLPEDEQIGSRQVSLPVSGGTLGRSFECTIQLPDFQRTLSRVHADIQPHPKG
GYQIIDRSTNGVFVNDVLVGKGESQRLSDGDRIVIGAYTLLVSDMDALLTRAPQQSDDTE
TASLKGAADSPFAASMVLDDSQDTAFGFAHLDEIQDAVQGETPFSTENVLGDDLYGYDPF
EDDERWVLEQSQSEDTTEQIVLMPEATQFNDNNHAPQHSVTVSDHRQIESLENSIEQLSS
MLKQQQLSVAGGIDRERLMTCIESTLEKFLDNFNPSHLEEEFNDYLSGWGNKDKKYWALY
KKQFQRKTERREFSRQFSSLLFEALREKR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgacgatcagttttcagataatcgaccttcctgaagatgaacaaatcggtagccgtcag
gtatcactgccggtcagtggcggcacgttaggacgctcgtttgagtgcaccattcagttg
ccggattttcagcgcacactgtcacgtgtccacgctgacattcaaccgcatccgaaaggc
ggctaccaaattatcgatcgcagtaccaacggcgtatttgtcaatgatgtgctggtgggc
aaaggcgaatcgcagcgcctcagcgatggcgaccggattgtgattggggcttacacctta
ttggtcagcgatatggatgcgttgttgacgcgcgcgccacaacagagcgacgacaccgaa
acggccagcctgaagggcgccgccgattcaccgtttgcggccagcatggtcttagatgac
agtcaggacaccgcatttggttttgcgcatctggacgagattcaagatgcggtgcaaggc
gagacgccgttttcgacggagaacgtgctgggcgatgacctgtatggttacgacccgttt
gaagacgatgagcgttgggtgctggagcagagccagagtgaagataccaccgaacagatt
gtgttgatgcccgaagcgactcagttcaatgacaacaatcatgccccgcagcacagtgtg
acggtcagcgatcatcgtcagatagagtcactggaaaacagcattgaacagctgagttcg
atgctcaaacagcaacagctgagcgtggcgggtggcattgaccgtgaacgtctgatgacc
tgcattgagtcgacactggaaaaattcctcgacaatttcaacccgagtcatctggaagag
gagttcaacgactatctttctggctgggggaacaaagataaaaaatattgggcgctgtat
aagaaacagttccagcgcaaaaccgagcgtcgggagttttcccgtcagttctcctccctg
ttatttgaagccctgagagagaaacgatga

DBGET integrated database retrieval system