KEGG   Viruses: 22220335
Entry
22220335          CDS       T40000                                 
Symbol
D1133L, ASFVgp101
Name
(RefSeq) African swine fever virus; helicase
  KO
K26854  African swine fever virus helicase
Virus
10497  African swine fever virus
SSDB
Motif
Pfam: Helicase_C ResIII DEAD TniB ATPase_2
Other DBs
NCBI-GeneID: 22220335
NCBI-ProteinID: NP_042799
RS: NC_001659
UniProt: Q89525 A0A0A1DYH2
Position
NC_001659:complement(123531..126932)
AA seq 1133 aa
MAYPELDAADFLQQLARRKEFKSLISPPVDQKELIRDLRAHFVQIGGPGCEKGGRAFFPC
DPYASPFPSIKGLQLHNAQLFVQNFQNPNTPYSRLLLNWQTGTGKSIAAIAIARQFMNHY
MNFIENAPWIFVVGFTRAIIQTEMLRRPELGFVSYKEVAELHRLLHIAKQSGSTTSVESR
HLNGFVSTLKRRLTDRNRGGFFQFYGYKEFASKLFNITSKGEEKNFDVLSLFHRSDEAED
TLNENDISQFVQKISEAETNGLIRVNQKIMEQLRGGLLIADEIHNVYNIQERNNYGIALQ
YVLDAFPPHQAPRAVFMSATPVTGSVMEYVDLLNLLVPRHELPNGQPLQRQQLFDSSGHS
VKWKKDALALVERLSTGRVSFLLDTNTNFYPERIFAGKMLSYKDETLPYLHFIECPMSEY
QLETLKQLGPDPKISSNAYSIYDMVFPNPKFSKQTEPKAYGLFNSTETPTALSMASTDWL
LENGVQIIEPSRRAPFNVSGSFLSLQPPTHISGLAFYSGKYTQMMKDILSIIRQGRGKIL
IYHNRVRMSGVLILQEILQSNGILNEVSSPVGTTRCSICAAIRDEHTHSDHQFIPVRFTI
LHSEIEPAVRERSLALFNASSNLEGHQLRILIGSKVIVEGLNFQAVRYEMIMSLPLDIPR
LIQVFGRVVRKNSHMELPPSERNVTIYLYVSTTPDGGPELAKYAQKLKEYILIQEGDKAL
RKHAIDGFTNQIKIDKPMLESLPLSPSITPANVGATVLNTFEAYGYGEQEVKTISNIIIS
LFMARPVWTYSELWKAVSTPKLIQGITIDNKLFSEDNFALALISLCYSKNQCKELWIQNR
LCTIMHVPAKPEHLYVAAVLNHKKEPVLDIETYIRDFQLPAMHSIRITKYLEHSQTKEPF
QVLYEKFQKDFQDEPMEQVLIHYPASFHYTMLEALIIDNLAGMGALVEVYKKFFIAFSKK
DIQPFPDIFKIISHVPGDDNTLVGYATEDSVRLITSREDKTWHEIPLYMLNINVKRKEND
IVIGYMESKGKALKFKIRPPIQVLKKNEITDIRMLNRGAVCETRGREEQQKIADQLGISL
NLTKISAIKLCLLIRNNLLQKEMEARNQPNGMQDGIRWFYLFNDKMPSLVHTS
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggcgtatcccgaattggatgccgcagactttttgcagcagttggcgcgaagaaaggag
tttaagtcgttgatttcccctcctgtcgaccaaaaagagctcattcgtgatctgcgggct
cattttgtccagatcggtgggcctggctgcgagaagggggggcgagcgttttttccgtgt
gacccctacgcgtcgccctttccttccatcaagggtctccaattgcataatgcccagctt
ttcgtccaaaactttcaaaaccccaacacaccctactcgcgtcttttattaaactggcag
accgggacgggaaaaagcattgccgcgattgccattgcgcgccaattcatgaaccactac
atgaattttattgaaaatgcgccctggatttttgtggtaggctttacacgcgccatcatt
caaacagaaatgctaagacgtcctgagctgggatttgtttcttacaaggaggtcgctgag
ctacaccggcttcttcacattgcaaagcagtctggcagcaccacgtcggttgaatcacgg
catctaaatgggttcgttagtacgttaaagcgccgtttaaccgatagaaaccgcggaggc
ttttttcagttttacggctataaggaatttgcatccaagcttttcaatattacgagtaag
ggtgaagagaaaaactttgatgtgctttctctgtttcatcgttctgacgaagcagaagat
acattgaatgagaacgatatatctcagttcgtgcaaaaaatcagcgaggccgagacaaac
ggcctcatccgggtgaatcaaaaaatcatggagcagcttaggggaggactgctcattgcg
gatgaaatacacaacgtgtacaatatccaggaacgaaataattatggcatcgctttacag
tatgtcctggatgcctttccacctcaccaggcccccagggccgtcttcatgtcggcaacg
cccgtaaccgggagtgtcatggaatacgtcgacctgttaaaccttttggttccgcggcat
gagctgcccaacggccagcccctccagcgccagcaactgtttgacagcagtgggcattcc
gttaaatggaaaaaggacgccctggctcttgtggaaagactcagcaccggaagggtatct
tttttgttggataccaacaccaatttttatcctgaaagaatatttgccggaaagatgttg
tcctataaagacgaaacattgccgtacttacatttcatcgaatgccccatgtctgagtat
cagcttgaaacgcttaaacagctgggccctgaccctaaaatctcgagtaatgcgtacagc
atttatgacatggtgtttcccaacccaaaattttcaaaacaaacggaacccaaggcttac
ggcctgtttaactcgacggaaacccccactgccctttctatggcaagcacagactggctt
ctggaaaacggggtacagattattgagccttcgcgtagagccccctttaatgtgagtggc
agctttttgtcgctgcagccaccaacgcacatctcgggattggccttttatagcggaaaa
tacactcaaatgatgaaagacattctttccattattcggcaaggccgggggaaaatttta
atttaccacaatcgggtccgcatgtcgggggttcttatcctgcaagaaattttacaaagt
aatggcattttaaatgaagtttcgtcccctgtgggaacgacccgctgctccatctgcgcc
gcgattcgcgatgagcacacacatagcgaccatcagtttattccagtacggttcaccatt
ctgcacagcgaaatagagcccgctgtacgcgaacgaagcctggctctttttaacgcctcg
tccaacctggaaggccaccagctgcgtattctcatcgggtccaaggtgattgtggagggt
ttgaactttcaggccgtgcggtacgagatgattatgtcattgccccttgatattccccgg
cttattcaggtatttgggagggtggtgcgaaaaaattcacacatggagcttccccccagt
gagcgcaacgtgacaatctatttgtacgtatcgacaacacccgatggagggccagagctt
gctaagtacgcacaaaaattaaaagaatacattttaatacaggagggggataaggcgctg
cgaaagcacgccattgatgggttcaccaaccagattaagattgataagcctatgctggaa
agtctgccccttagtccatccatcacgccggcaaacgtcggagccaccgtcctcaatacc
tttgaggcctatggatacggggagcaagaggtaaaaacaatttctaatattattatatct
ttgtttatggcacgccccgtgtggacgtactccgagctatggaaggcagtttccacgccc
aagctcatacagggaattaccatcgataataaactcttctcagaggacaacttcgcgctg
gcgctcatttctctatgctactcaaaaaaccagtgcaaggaattatggatacagaatcgt
ctttgcaccattatgcatgtgccggcaaagcctgagcatttgtacgtcgctgcggtgctt
aaccataaaaaggaaccggtattagatattgaaacatatattcgggattttcagcttccc
gcgatgcacagcatccgtattaccaaatacctcgaacactcgcagaccaaagaacccttt
caagtattgtatgaaaagtttcagaaggattttcaggatgagccaatggagcaggtactc
atccattatcccgcttcatttcactatacgatgctagaagcacttattatagataatctt
gcaggtatgggggcccttgtcgaggtttataaaaagtttttcatcgctttttcaaaaaaa
gatattcagccatttccggacatttttaaaattataagccacgtgcctggggatgacaac
actctggtgggctatgccacggaggactccgtgcgacttattacctcgcgagaagataaa
acctggcatgaaattccgctctatatgcttaatattaatgttaaacgaaaagaaaacgac
attgtcataggctatatggaaagcaagggaaaggcccttaaatttaaaatccgcccacct
atccaggttttaaaaaagaacgagattactgatattcgcatgctaaaccggggagccgta
tgcgaaacacgcggacgggaggagcaacaaaaaattgctgaccaattgggcataagttta
aaccttacaaagattagtgccatcaagctctgcttactcattcgcaataaccttttgcaa
aaagaaatggaggctcgtaatcaaccaaatggaatgcaggatggaatccgctggttttac
ctttttaacgacaaaatgccgtcacttgtgcacacatcttag

DBGET integrated database retrieval system