KEGG   Viruses: 2947897
Entry
2947897           CDS       T40000                                 

Gene name
BPSVgORF006
Definition
(RefSeq) Bovine papular stomatitis virus; vascular endothelial growth factor like protein
  KO
K22612  Poxvirus vascular endothelial growth factor A homolog
Taxonomy
TAX:129727
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Parapoxvirus
Organism
vg  Viruses (Bovine papular stomatitis virus)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 2947897
NCBI-ProteinID: NP_957915
RS: NC_005337
UniProt: Q6TVI2
Position
NC_005337:complement(4904..5362)
AA seq 152 aa
MKCLIVCMQWSLALLLCLQCVKWMQAAPTSSNGNHEVEKWSDVYDNSRCQPMKTPVKVSD
EYPDNTNDRHSPPCVTLMRCGGCCNDESLECVPTETSNVTMQIMTTSAYNDGGTSGGISS
GMREMSFLQHNKCECRPKSTPPPETTEESHRR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaagtgcttaatagtgtgcatgcaatggagcctcgcgttactactctgcctccaatgt
gtaaagtggatgcaggctgcaccaacatcaagtaatggtaatcatgaagtagaaaagtgg
agtgacgtttacgacaatagccgttgccagcctatgaaaacacctgtaaaggtgtcagac
gaataccctgataatacaaatgatagacatagtcctccgtgcgttactttgatgcgttgt
gggggatgctgtaacgatgaaagtttggaatgtgttcccacggaaacgtctaacgtaaca
atgcaaatcatgacaacatcagcatacaacgacggtgggaccagtggtggtattagtagt
ggaatgcgtgaaatgagtttcctacaacataacaaatgtgagtgcagacccaagtcaaca
cctcccccagaaaccactgaggaatcacacagacgatag

DBGET integrated database retrieval system