KEGG   Viruses: 43740575
Entry
43740575          CDS       T40000                                 

Gene name
N, GU280_gp10
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; nucleocapsid phosphoprotein
  KO
K24106  SARS coronavirus nucleocapsid protein
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
Motif
Pfam: CoV_nucleocap
Other DBs
NCBI-GeneID: 43740575
NCBI-ProteinID: YP_009724397
RS: NC_045512
UniProt: P0DTC9
Position
NC_045512:28274..29533
AA seq 419 aa
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG
KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG
LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY
KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgtctgataatggaccccaaaatcagcgaaatgcaccccgcattacgtttggtggaccc
tcagattcaactggcagtaaccagaatggagaacgcagtggggcgcgatcaaaacaacgt
cggccccaaggtttacccaataatactgcgtcttggttcaccgctctcactcaacatggc
aaggaagaccttaaattccctcgaggacaaggcgttccaattaacaccaatagcagtcca
gatgaccaaattggctactaccgaagagctaccagacgaattcgtggtggtgacggtaaa
atgaaagatctcagtccaagatggtatttctactacctaggaactgggccagaagctgga
cttccctatggtgctaacaaagacggcatcatatgggttgcaactgagggagccttgaat
acaccaaaagatcacattggcacccgcaatcctgctaacaatgctgcaatcgtgctacaa
cttcctcaaggaacaacattgccaaaaggcttctacgcagaagggagcagaggcggcagt
caagcctcttctcgttcctcatcacgtagtcgcaacagttcaagaaattcaactccaggc
agcagtaggggaacttctcctgctagaatggctggcaatggcggtgatgctgctcttgct
ttgctgctgcttgacagattgaaccagcttgagagcaaaatgtctggtaaaggccaacaa
caacaaggccaaactgtcactaagaaatctgctgctgaggcttctaagaagcctcggcaa
aaacgtactgccactaaagcatacaatgtaacacaagctttcggcagacgtggtccagaa
caaacccaaggaaattttggggaccaggaactaatcagacaaggaactgattacaaacat
tggccgcaaattgcacaatttgcccccagcgcttcagcgttcttcggaatgtcgcgcatt
ggcatggaagtcacaccttcgggaacgtggttgacctacacaggtgccatcaaattggat
gacaaagatccaaatttcaaagatcaagtcattttgctgaataagcatattgacgcatac
aaaacattcccaccaacagagcctaaaaaggacaaaaagaagaaggctgatgaaactcaa
gccttaccgcagagacagaagaaacagcaaactgtgactcttcttcctgctgcagatttg
gatgatttctccaaacaattgcaacaatccatgagcagtgctgactcaactcaggcctaa

DBGET integrated database retrieval system