KEGG   Viruses: 944639
Entry
944639            CDS       T40000                                 

Gene name
SPPV_40
Definition
(RefSeq) Sheeppox virus; hypothetical protein
Taxonomy
TAX:10266
  Lineage
Viruses; dsDNA viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota; Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae; Capripoxvirus
Organism
vg  Viruses (Sheeppox virus)
SSDB
Motif
Pfam: Pox_EPC_I2-L1 Orf78 DUF2116
Other DBs
NCBI-GeneID: 944639
NCBI-ProteinID: NP_659616
RS: NC_004002
UniProt: A0A2H4F2F7 A0A3F2YKK3
Position
NC_004002:complement(38659..38874)
AA seq 71 aa
MDKLYSAIFGVFMSSSDDDFNNFINVVKSVLNNENYNKKTKKSFLRNYLIIGLVTIVFVI
IFIIFYLKVIK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggataagttgtattctgcaatatttggagtttttatgtcatcgtcagatgatgacttt
aataactttataaatgttgtcaaatcagttttaaacaacgaaaattataacaaaaagact
aaaaaatcatttttaagaaattatttaattattggattagttacgattgtttttgttata
atttttatcattttttatttaaaagttataaaatga

DBGET integrated database retrieval system