KEGG   Vibrio harveyi: AL538_03170Help
Entry
AL538_03170       CDS       T04380                                 

Definition
(GenBank) GTP cyclohydrolase II RibA
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
vhr  Vibrio harveyi
Pathway
vhr00740  Riboflavin metabolism
vhr00790  Folate biosynthesis
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr02024  Quorum sensing
Module
vhr_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AL538_03170
   00790 Folate biosynthesis
    AL538_03170
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL538_03170
Enzymes [BR:vhr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AL538_03170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AMF99370
UniProt: K5UMG2
Position
1:complement(653946..654542)
Genome map
AA seq 198 aa AA seqDB search
MAEVRARVDFKVGANSNIDAEILSFRGLKTDKEHVAIIFKQADQTQDMPLVRMHSECLTG
DVFHSSRCDCGEQLEETINRMGESGGIILYLRQEGRGIGLYNKIDAYRLQSQGMNTYEAN
NHLGFDDDLRDFTEAAQMLEALGVGKIRLVTNNPKKIRELSEYGIEITEVVNTSAHIKDG
NENYLKAKVSHGKHHLKV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtacgtgccagagtagattttaaagtcggggctaacagtaacattgatgcc
gaaatcctgtcttttcgcggtctgaagacggataaagagcatgtagcaattatctttaag
caagcagaccaaacacaagacatgcctttagtgcgcatgcactctgagtgtctgactggt
gatgtgttccactcttcacgctgtgactgtggcgagcaattggaagaaaccatcaaccga
atgggtgagtcaggtggcattatcttatatcttcgccaagaaggtcgcgggatcggtttg
tacaacaaaattgatgcgtaccgtttacaaagccagggtatgaacacatatgaagccaac
aaccacctaggctttgatgatgacttgcgcgatttcaccgaagcggcacaaatgcttgag
gcgttaggggttggaaaaatccgtctcgtaactaataatcctaaaaaaatccgtgagtta
tcggaatacggaattgaaattacagaggttgtcaacacttcagcgcacattaaagatggc
aatgaaaattatcttaaagcaaaggtttcacacgggaaacaccacctaaaggtttaa

DBGET integrated database retrieval system